DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gen and exo1

Sequence 1:NP_647943.2 Gene:Gen FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_998634.1 Gene:exo1 ZFINID:ZDB-GENE-040426-2828 Length:806 Species:Danio rerio

Alignment Length:831 Identity:186/832 (22%)
Similarity:293/832 (35%) Gaps:252/832 (30%)


  Fly     1 MGVKELWGVLTPHCERKPINELRGKKVAIDLAGWV-------CESL-------NVVDY---FVHP 48
            ||::.|...:....|...:.:.||:.||:|...|:       .|.|       ..|.|   ||. 
Zfish     1 MGIQGLLQFIKDASEPMHVKKYRGQTVAVDTYCWLHKGAFSCAEKLAKGEPTDQYVSYCMKFVD- 64

  Fly    49 RHHLKNLFFRTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNE-----LQ-----FRGVKPKNSPE 103
                        .|:...|.|:.|.:|.....|.:|...|.|     ||     .|..|...:.|
Zfish    65 ------------MLLSFGVKPILVFDGRNLPSKQEVEKSRRERRQANLQKGKQLLREGKITEARE 117

  Fly   104 C-TQS---QPSKGDKGRSRFNHVLKQCETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQD 164
            | |:|   .||..       :.|::...|    .|:.||..|.||:|..|||||..:...||::|
Zfish   118 CFTRSVNITPSMA-------HDVIRAART----RGVDCVVAPYEADAQLAFLNKSDIAQAVITED 171

  Fly   165 SDCFAYGAVRVYRNFSVSTQG---AQAAAGGAVDIYDMREITSRMDFGQQKIIVMALLCGCDYCP 226
            ||..|:|..:|.........|   .|...|....:.::        |.::|...|.:|.||||. 
Zfish   172 SDLLAFGCKKVILKMDKQGNGLEIEQCHLGRCKSLGNI--------FTEEKFRYMCILSGCDYL- 227

  Fly   227 DGIGGIGKDGVLKLFNKYKETEILDRMRSWRGETDKYNALEIRVDDKSICSNCGHIGKTQSH--- 288
            ..:.|||.....||.......:||..::    :..:|..::|.|.::.|      .|.|:::   
Zfish   228 QSLYGIGLGKACKLLRMANNPDILKVIK----KMGQYLKMDISVPEEYI------EGFTKANNTF 282

  Fly   289 -----------------------TKSGCSVCRTHKGCDESLWKEQRLSIKSELTLRRKALLSPDF 330
                                   ..:..|...|:.|.::.|  :..|......|::|....:||.
Zfish   283 LYQLVFDPLRRKVVPLNPYPDHINPAALSYAGTNVGDEKGL--QMALGNLDINTMQRIDDFNPDA 345

  Fly   331 PNEEIIAEFLSEPDTIPNLNLNWR---------QPNLVKFIKQIGHLLQWPEIYCFQKFFPILTR 386
            |.        ::|...|. :.:|.         |.::            |.     |.:.|..|:
Zfish   346 PQ--------TQPPKAPR-SSSWNDRCDKTATTQASI------------WS-----QNYEPGCTK 384

  Fly   387 WQVQQSKQEKILIQPHEIIKKRTVKGVPSLELRWHDPSGIFKGLIPDKQIAEYEAEHPKGIEELY 451
            .|...|.:     :|.....|..:..|.||:|             |.:   |.:.:.|:  |:..
Zfish   385 SQSPTSPK-----RPPPTRGKERIVSVQSLKL-------------PQR---ESQVKRPR--EDTS 426

  Fly   452 YTIEPLDMLETAYPDLVAAFLKSKEKPAKKTTRKKKTASEEENKENE--PNSKPKRVVRKIKAQP 514
            .:::  |:||.     ..|.:| :..|..:.|.|..|...:.:|||.  ..|.|.|        |
Zfish   427 LSVD--DLLEQ-----YTAGVK-RHCPETQPTTKPLTNDNKVSKENHCGSTSGPFR--------P 475

  Fly   515 EENQPLLHQFLGRKKEGTPVKAPAPQRQQCSTPITKFLPSDLESDCDAEEFDMSDIVKGIISNPN 579
            ......|.|:..|.:|||      .::..||    :|...|..:..:.:|....|..:.:.|. .
Zfish   476 RNRFATLLQWRNRSEEGT------EEQGTCS----RFFCHDESNIAETQEDSKQDSSQSVESQ-E 529

  Fly   580 AKPALTNHDGHQLHYEPMAE-------------DLSLRLAQMSLG-------------NVNESPK 618
            ...:.:..|...|..||..|             ..|.|.|.:.||             :|:...:
Zfish   530 KHVSQSGGDTSSLCEEPEREQDKDEPSSPPASPSCSSRPASVGLGVFSWSGTTKELNKSVSHPAR 594

  Fly   619 VETKRD--------LSQVDQLPQSK-RFSLEDSFDLLVKGDLQKLARTPVERFKMQHRISEKI-P 673
            ..|:|.        ||.:.|..::| |.|.        .|....|:.:|||.       ||.. .
Zfish   595 DSTERQRSSSTPSGLSTLQQFHRNKARISW--------AGPGLSLSSSPVEG-------SEDAGN 644

  Fly   674 TPVKPLDNISYFFNQSSD-NADVFEELMNSSLVPQDQEDNAEDEEEDDLVV 723
            :|..|....|.:|:|||. :|.|     .:|||   .|||::.|:|.|.||
Zfish   645 SPGSPPSQDSAYFSQSSSISASV-----ENSLV---TEDNSDKEKERDSVV 687

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 98/453 (22%)
H3TH_GEN1 210..342 CDD:188625 30/158 (19%)
exo1NP_998634.1 PIN_EXO1 1..206 CDD:189027 60/229 (26%)
N-domain 1..99 25/111 (23%)
I-domain 138..229 32/104 (31%)
H3TH_EXO1 213..289 CDD:188628 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.