DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gen and Fen1

Sequence 1:NP_647943.2 Gene:Gen FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_523765.1 Gene:Fen1 FlyBaseID:FBgn0025832 Length:385 Species:Drosophila melanogaster

Alignment Length:527 Identity:111/528 (21%)
Similarity:192/528 (36%) Gaps:174/528 (33%)


  Fly     1 MGVKELWGVLTPHCERKPINELR---GKKVAIDLAGWVC----------ESLNVVDYFVHPRHHL 52
            :|:.:|...|.|...|:  :|::   |:|||||.:  :|          |...:......|..||
  Fly     4 LGLSKLIADLAPQAIRE--SEMKHFFGRKVAIDAS--MCLYQFLIAVRSEGAQLATVNGDPTSHL 64

  Fly    53 KNLFFRTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPSKG-DKGR 116
            ..:|:||..|:...:.||:|.:|..|.|||..:|||.|      :.:.:.:..::....| |.|.
  Fly    65 MGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAE------RREEAEKALKAATDAGDDAGI 123

  Fly   117 SRFNHVL--------KQCETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGAV 173
            .:||..|        |:.:.||..||:..|..|.||||.||.|.|.|.|....::|.|...:|:.
  Fly   124 EKFNRRLVRVTKEHAKEAKELLTLMGVPYVDAPCEAEAQCAALVKAGKVYATATEDMDALTFGST 188

  Fly   174 RVYRNFSVSTQGAQAAAGGAVDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIGKDGVL 238
            ::.|..:.|     .|....|..:...::...:....::.|.:.:|.||||| :.|.|||....:
  Fly   189 KLLRYLTYS-----EARKMPVKEFSYDKLLEGLAINNREFIDLCILLGCDYC-ESIKGIGPKRAI 247

  Fly   239 KLFNKYKETE-ILDRMRSWRGETDKYNALEIRVDDKSICSNCGHIGKTQSHTKSGCSVCRTHKGC 302
            :|.|.|::.| |||.:     ::.||..                                     
  Fly   248 ELINTYRDIETILDNL-----DSSKYTV------------------------------------- 270

  Fly   303 DESLWKEQRLSIKSELTLRRKALLSPDFPNEEIIAEFLSEPDT--IPNLNLNWRQPN---LVKFI 362
                                     |:..|.::..|...||:.  ..:::|.|.:|:   ||||:
  Fly   271 -------------------------PENWNYKVARELFIEPEVADADSIDLKWVEPDEEGLVKFL 310

  Fly   363 KQIGHLLQWPEIYCFQKFFPILTRWQVQQSKQEKILIQPHEIIKKRTVKGVPSLELRWHDPSGIF 427
                         |..:           |..:|::.....:::|.:                   
  Fly   311 -------------CGDR-----------QFNEERVRNGAKKLMKSK------------------- 332

  Fly   428 KGLIPDKQIAEYEAEHPKGIEELYYTIEPLDMLETAYPDLVAAFLKSKEKPAKKTTRKKKTASEE 492
                        :|:....::..:.|:       .:.|:...| .|.|.:.|||:...||..:..
  Fly   333 ------------QAQTQVRLDSFFKTL-------PSTPNATNA-AKRKAEEAKKSANNKKAKTSG 377

  Fly   493 ENKENEP 499
            ..:...|
  Fly   378 GGRGRRP 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 96/412 (23%)
H3TH_GEN1 210..342 CDD:188625 23/133 (17%)
Fen1NP_523765.1 PTZ00217 1..363 CDD:240317 105/505 (21%)
PIN_FEN1 5..344 CDD:189037 100/477 (21%)
H3TH_FEN1-Euk 222..290 CDD:188627 25/136 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108367309
eggNOG 1 0.900 E1_COG0258
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11081
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.