DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gen and tos

Sequence 1:NP_647943.2 Gene:Gen FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_477145.1 Gene:tos FlyBaseID:FBgn0015553 Length:732 Species:Drosophila melanogaster

Alignment Length:745 Identity:145/746 (19%)
Similarity:265/746 (36%) Gaps:205/746 (27%)


  Fly     1 MGVKELWGVLTPHCERKPINELRGKKVAIDLAGWV-------CESL-NVVDYFVHPRHHLKNLFF 57
            ||:..|...:.....:..:.::||..||:|...|:       .|.| ...|..|:.::.||.:..
  Fly     1 MGITGLIPFVGKASSQLHLKDIRGSTVAVDTYCWLHKGVFGCAEKLARGEDTDVYIQYCLKYVNM 65

  Fly    58 RTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPSKGDKGRSRFN-- 120
            ...|    .:.|:.|.:|  ..|.::.:.::.....|....:.:.|..:.  .:.::.||...  
  Fly    66 LLSY----DIKPILVFDG--QHLPAKALTEKRRRDSRKQSKERAAELLRL--GRIEEARSHMRRC 122

  Fly   121 ---------HVLKQCETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGAVRVY 176
                     .::::|.    |..:.|:..|.||:|..|:||:..:...:|::|||...:||..:.
  Fly   123 VDVTHDMALRLIRECR----SRNVDCIVAPYEADAQMAWLNRADVAQYIITEDSDLTLFGAKNII 183

  Fly   177 RNFSVSTQG-------AQAAAGGAVDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIGK 234
            ....::..|       ...|.|...:.|..           .|...|.:|.||||. |.:.|||.
  Fly   184 FKLDLNGSGLLVEAEKLHLAMGCTEEKYHF-----------DKFRRMCILSGCDYL-DSLPGIGL 236

  Fly   235 DGVLKLFNKYKETEI---LDRMRSWRG----ETDK------------------YNALEIRVD--- 271
            ....|...|.::.::   |.::.|:..    |.|.                  ||.||.|:.   
  Fly   237 AKACKFILKTEQEDMRIALKKIPSYLNMRNLEVDDDYIENFMKAEATFRHMFIYNPLERRMQRLC 301

  Fly   272 -------DKSICSNCGHI---GKTQSHTKSG----CSVCRTHKGCDESLWKEQRLSIKSELTLRR 322
                   |:..|||.|.:   .:...|...|    .|:.|......|..|...: ::|..   :.
  Fly   302 ALEDYETDERYCSNAGTLLEDSEQALHLALGNLNPFSMKRLDSWTPEKAWPTPK-NVKRS---KH 362

  Fly   323 KALLSPDFPNEEIIAEFLSEPDTIPNLNLNWRQPNLVKFIKQ---IGHLLQWPEIYCFQKFFPIL 384
            |::...:|.:|              |.:...::.....|.|:   :|..|. .||...|:     
  Fly   363 KSIWQTNFQSE--------------NTHTPKKENPCALFFKKVDFVGKTLN-EEIEANQR----- 407

  Fly   385 TRWQVQQSKQ-EKILIQPHEIIKKRTVKGVPSLE-----LRWHDPSGIFKG-------------- 429
                ::|:|| |..|...:....||  :..||.|     .|...||.:.|.              
  Fly   408 ----LEQAKQTEAELFNMYSFKAKR--RRSPSREDSVDQERTPPPSPVHKSRHNPFAKERTGEEA 466

  Fly   430 ---------------LIPDKQIAEYEAEHPKGIEELYYTIEPLDMLETAYPDLVAAFLKSKEKPA 479
                           |:..|:.:..:.|  .|:::       :|.|:.      :.|.|.:.:..
  Fly   467 NQRSPVVCENASLLRLLSPKKASPLDGE--AGVKK-------VDSLKR------SIFAKEQVQIR 516

  Fly   480 KK--TTRKKKTASEEENKENEPNSKPKRVVRKIKAQPEENQPLLHQFLGRKK-----EGTPVKAP 537
            .:  .|:.::|..:.|:..:..|.             :.::..|....|.||     :..|.|.|
  Fly   517 SRFFATQDEQTRLQREHLRDTEND-------------DMDEQKLSSHSGHKKLRLVCKDIPGKNP 568

  Fly   538 APQRQQCSTPITKFLPSDLESDCDAEEFDMSDIV-KGIISNPNAKPALTNHDGHQLHYEPMAEDL 601
            .  ||:||:.|     ||.|:|.|.....:.:.. ||:.|...::..| |:...|:..|......
  Fly   569 I--RQRCSSQI-----SDGETDTDTTASSLLESQDKGVPSPLESQEDL-NNSQPQIPTEGNTNST 625

  Fly   602 SLRLAQMSLGNVNESPKVETKRDLSQVDQL 631
            ::|:..:.| .:..||:...:.|.:..|.:
  Fly   626 TIRIKSLDL-LLENSPEPTQESDRNNNDAI 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 89/455 (20%)
H3TH_GEN1 210..342 CDD:188625 37/174 (21%)
tosNP_477145.1 PIN_EXO1 1..204 CDD:189027 42/215 (20%)
H3TH_EXO1 214..291 CDD:188628 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108370829
eggNOG 1 0.900 E1_COG0258
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11081
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.