DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gen and GEN1

Sequence 1:NP_647943.2 Gene:Gen FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001123481.3 Gene:GEN1 HGNCID:26881 Length:908 Species:Homo sapiens

Alignment Length:740 Identity:213/741 (29%)
Similarity:346/741 (47%) Gaps:101/741 (14%)


  Fly     1 MGVKELWGVLTPHCERKPINELRGKKVAIDLAGWVCESLNV---VDYFVHPRHHLKNLFFRTCYL 62
            |||.:||.:|.|..:..|:..|.||.:|:||:.||||:..|   :...:.|  ||:|||||..||
Human     1 MGVNDLWQILEPVKQHIPLRNLGGKTIAVDLSLWVCEAQTVKKMMGSVMKP--HLRNLFFRISYL 63

  Fly    63 IWEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPSKGDKGRSRFNHVLKQCE 127
            ....|..|||:||..||||:.||:|||:.:: |...|:..:.|         |||.|..||::|.
Human    64 TQMDVKLVFVMEGEPPKLKADVISKRNQSRY-GSSGKSWSQKT---------GRSHFKSVLRECL 118

  Fly   128 TLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGAVRVYRNFSVSTQGAQAAAGG 192
            .:|..:||..||..|||||.||:||..|.|||.::.|.|.|.|||..|||||:::|:...     
Human   119 HMLECLGIPWVQAAGEAEAMCAYLNAGGHVDGCLTNDGDTFLYGAQTVYRNFTMNTKDPH----- 178

  Fly   193 AVDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIGKDGVLKLFNKYKETEILDRMRSWR 257
             ||.|.|..|.|::...:..::.:|:|.||||.|.|:.|:||:..|||....|...:|.|...| 
Human   179 -VDCYTMSSIKSKLGLDRDALVGLAILLGCDYLPKGVPGVGKEQALKLIQILKGQSLLQRFNRW- 241

  Fly   258 GETDKYNALEIRVDDK-SICSNCGHIGKTQSHTKSGCSVCRTHKGCDESLWK------------E 309
            .||...::.::.|..| :.||.|.|.|..:.|.::||.:|::.|.|:...::            :
Human   242 NETSCNSSPQLLVTKKLAHCSVCSHPGSPKDHERNGCRLCKSDKYCEPHDYEYCCPCEWHRTEHD 306

  Fly   310 QRLSIKSELTLRRKALLSPDFPNEEIIAEFLSEPDTIPNLNLNWRQPNLVKFIKQIGHLLQWPEI 374
            ::|| :.|..:::||.....||..|:|.|||...|.:..: :.:::|:|:.|.:.....::||..
Human   307 RQLS-EVENNIKKKACCCEGFPFHEVIQEFLLNKDKLVKV-IRYQRPDLLLFQRFTLEKMEWPNH 369

  Fly   375 YCFQKFFPILTRWQVQQSK---QEKILIQPHEIIKKRTVKGVPSLELRWHDPSGIFKGLIPDKQI 436
            |..:|...:||.:.:.:.|   :....:||..|:|.|...||...|:.|..|...   .:.|||.
Human   370 YACEKLLVLLTHYDMIERKLGSRNSNQLQPIRIVKTRIRNGVHCFEIEWEKPEHY---AMEDKQH 431

  Fly   437 AEYEAEHPKGIEELYYTIEPLDMLETAYPDLVAAFLKSKEKPAKKTTRKKKTASEEENKENEPN- 500
            .|:          ...|||...:.|.|||::||.:.|.|.:...|   |:|....:||...||: 
Human   432 GEF----------ALLTIEEESLFEAAYPEIVAVYQKQKLEIKGK---KQKRIKPKENNLPEPDE 483

  Fly   501 --SKPKRVVRKIKAQPEENQPLLHQFLGRKKEGTPVKAPAPQRQQCSTPITKFLPSDLESDC-DA 562
              |....:..|...:      :.|:...:...|.......||....::..:..||.:  :.| :|
Human   484 VMSFQSHMTLKPTCE------IFHKQNSKLNSGISPDPTLPQESISASLNSLLLPKN--TPCLNA 540

  Fly   563 EEFDMSDI-------VKGIISNPNAKPALTNHDGHQLHYEPMAEDLSLRLAQMSLGNVNESPKVE 620
            :|..||.:       :|.:..:..::.:..|...|.:   .:..||.|........:.:.||.::
Human   541 QEQFMSSLRPLAIQQIKAVSKSLISESSQPNTSSHNI---SVIADLHLSTIDWEGTSFSNSPAIQ 602

  Fly   621 TKRDLSQVDQLPQSKRFSLEDSFDLLVKGDLQKLARTPVERFKMQHRISEKIPTPVKPLDNISYF 685
            .......:....:|:..::.|.|:     ::.:......||:..                ||...
Human   603 RNTFSHDLKSEVESELSAIPDGFE-----NIPEQLSCESERYTA----------------NIKKV 646

  Fly   686 FNQSSDNADVFEELMN--SSLVPQD 708
            .::.||.....|.|::  :.|..||
Human   647 LDEDSDGISPEEHLLSGITDLCLQD 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 144/400 (36%)
H3TH_GEN1 210..342 CDD:188625 45/145 (31%)
GEN1NP_001123481.3 PIN_GEN1 1..193 CDD:189039 90/210 (43%)
XPG-N domain. {ECO:0000269|PubMed:26682650} 2..96 44/97 (45%)
XPG-I domain. {ECO:0000269|PubMed:26682650} 122..208 39/92 (42%)
H3TH_GEN1 195..338 CDD:188625 45/145 (31%)
5'-3' exonuclease domain. {ECO:0000269|PubMed:26682650} 208..384 51/179 (28%)
Chromodomain. {ECO:0000269|PubMed:26682650} 390..464 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C325369533
eggNOG 1 0.900 E1_COG0258
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I2934
Isobase 1 0.950 0 Normalized mean entropy S5877
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094524at2759
OrthoFinder 1 1.000 FOG0009091
OrthoInspector 1 1.000 T1074721
orthoMCL 1 0.900 OOG5_134343
Panther 1 1.100 LDO PTHR11081
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.