DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gen and FEN1

Sequence 1:NP_647943.2 Gene:Gen FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_004102.1 Gene:FEN1 HGNCID:3650 Length:380 Species:Homo sapiens

Alignment Length:522 Identity:115/523 (22%)
Similarity:195/523 (37%) Gaps:171/523 (33%)


  Fly     2 GVKELWGVLTPHCERKPINELR---GKKVAIDLAGWVCESLNVVDYFVHPRH------------- 50
            |:.:|...:.|...|:  |:::   |:|||||      .|:::..:.:..|.             
Human     5 GLAKLIADVAPSAIRE--NDIKSYFGRKVAID------ASMSIYQFLIAVRQGGDVLQNEEGETT 61

  Fly    51 -HLKNLFFRTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPSKGDK 114
             ||..:|:||..::...:.||:|.:|..|:|||..:|||:|.:....|.....:...:: .:.:|
Human    62 SHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE-QEVEK 125

  Fly   115 GRSRFNHVLKQ----CETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGAVRV 175
            ...|...|.||    |:.||..|||..:..|.||||.||.|.|.|.|....::|.||..:|:..:
Human   126 FTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVL 190

  Fly   176 YRNFSVSTQGAQAAAGGAVDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIGKDGVLKL 240
            .|:.:     |..|....:..:.:..|...:...|::.:.:.:|.|.||| :.|.|||....:.|
Human   191 MRHLT-----ASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYC-ESIRGIGPKRAVDL 249

  Fly   241 FNKYKETEILDRMRSWRGETDKYNALEIRVDDKSICSNCGHIGKTQSHTKSGCSVCRTHKGCDES 305
            ..|:|..|.:.|    |.:.:||...|          |..|   .::|                 
Human   250 IQKHKSIEEIVR----RLDPNKYPVPE----------NWLH---KEAH----------------- 280

  Fly   306 LWKEQRLSIKSELTLRRKALLSPDFPNEEIIAEFLSEPDTIPNLNLNWRQPN---LVKFIKQIGH 367
                             :..|.|:          :.:|:::   .|.|.:||   |:||:     
Human   281 -----------------QLFLEPE----------VLDPESV---ELKWSEPNEEELIKFM----- 310

  Fly   368 LLQWPEIYCFQKFFPILTRWQVQQSKQEKILIQPHEIIKKRTVKGVPSLELRWHDPSGIFKGLIP 432
                    |.:|           |..:|:|......:.|.|               .|..:|.:.
Human   311 --------CGEK-----------QFSEERIRSGVKRLSKSR---------------QGSTQGRLD 341

  Fly   433 DKQIAEYEAEHPKGIEELYYTIEPLDMLETAYPDLVAAFLKSKEKPAKKTTRKK-KTASEEENKE 496
            |                 ::.:  ...|.:|         |.||...|.:|:|| ||.:..:.|.
Human   342 D-----------------FFKV--TGSLSSA---------KRKEPEPKGSTKKKAKTGAAGKFKR 378

  Fly   497 NE 498
            .:
Human   379 GK 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 95/407 (23%)
H3TH_GEN1 210..342 CDD:188625 24/132 (18%)
FEN1NP_004102.1 PTZ00217 1..373 CDD:240317 114/514 (22%)
N-domain 1..104 30/107 (28%)
I-domain 122..253 42/137 (31%)
Interaction with PCNA. {ECO:0000269|PubMed:9305916} 336..344 2/25 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.