DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gen and xpg-1

Sequence 1:NP_647943.2 Gene:Gen FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_491891.2 Gene:xpg-1 WormBaseID:WBGene00019004 Length:820 Species:Caenorhabditis elegans

Alignment Length:559 Identity:136/560 (24%)
Similarity:204/560 (36%) Gaps:194/560 (35%)


  Fly    65 EQVTPVFVLEGVAPKL--------KSQVIAKRNELQF---RGVKPKNSPECTQSQPS-------- 110
            |.|....:||..|..|        |.:|.::..|:::   |..||.     |.|.|:        
 Worm   397 EMVLQEVLLETAAKSLDKRMASLEKHKVPSEDEEIEWDPQRYDKPS-----TSSAPALMEDYIHL 456

  Fly   111 ----KGDKGRSRFNHVLKQCETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYG 171
                :.||....:    :..:..|.:.||..::.||||||.|..|.:.||||||:|.|||.:|:|
 Worm   457 NYSDEDDKTPELY----RDLQEFLTNAGIPWIESPGEAEAQCVELERLGLVDGVVSDDSDVWAFG 517

  Fly   172 AVRVYR-----NFSVSTQGAQAAAGGAVDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGG 231
            |..|||     |..|...|.|..|.        |:........::..|.:|||.|.|||. |:..
 Worm   518 AQHVYRHMFSKNRRVQRYGEQTTAN--------RDNCKLFCLQREDYISIALLSGGDYCA-GLVK 573

  Fly   232 IGKDGVLKLFNKYKETEILDRMRSWRGETDKYNALEIRVDDKSICSNCGHIGKTQSHTKSGCSVC 296
            :|..|.|:|.::|.|..|           |..|.|:: ::::                     :.
 Worm   574 VGAIGALELVSEYVECRI-----------DNTNDLKV-IENR---------------------IM 605

  Fly   297 RTHKGCDESLW----KEQRLSIKSELTLRRKALLSPDFPNEEIIAEFLSEPDTI----------P 347
            |..|.. |||:    .::|::.::.:.|||....:.|..|.:.:.   |..|.:          .
 Worm   606 RLLKNV-ESLFLTAPDDKRVASRNAMMLRRHVTEANDMENIKCVC---SNQDAVHAYLHPIVDSS 666

  Fly   348 NLNLNWRQPNLVKFIKQIGH-LLQWPE----------IYCFQKFFPILTRWQVQQSKQEKILIQP 401
            :..|.|||.| :..|::|.| .||||:          ...|:|:...|......|.:.::...| 
 Worm   667 SEKLRWRQMN-IPLIRRILHQRLQWPDRKQHNEEQNSFDAFEKWNNFLKSGGQSQMRLDRFFAQ- 729

  Fly   402 HEIIKKRTVKGVPSLELRWHDPSGIFKGLIPDKQIAEYEAEHPKGIEELYYTIEPLDMLETAYPD 466
                     |...||||:|            .|:|                 :|.||.:    ..
 Worm   730 ---------KLDSSLELKW------------SKKI-----------------VEALDKI----GQ 752

  Fly   467 LVAAFLK----SKEKPAKKTTRKKKTASEEENKENEPNSKPKRVVRKIKAQPEENQPLLHQFLGR 527
            .||..:|    ||||...|..:|.|||             .|||.|.             :.:||
 Worm   753 RVAGTMKNNEMSKEKKVDKQIKKSKTA-------------VKRVTRA-------------RGIGR 791

  Fly   528 KKEGTPVKAPAPQRQQCSTPITKFLPSDLESDCDAEEFD 566
            .|.|. :..||..:...|           |.....:.||
 Worm   792 GKGGA-LLVPANSKLNLS-----------EESSSNDSFD 818

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 97/373 (26%)
H3TH_GEN1 210..342 CDD:188625 31/136 (23%)
xpg-1NP_491891.2 PIN_SF 1..>111 CDD:301351
PIN_SF <449..548 CDD:301351 35/111 (32%)
H3TH_XPG-like 554..>586 CDD:188620 13/33 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I3133
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.