DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gen and ercc5

Sequence 1:NP_647943.2 Gene:Gen FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:XP_012811722.1 Gene:ercc5 XenbaseID:XB-GENE-960380 Length:1251 Species:Xenopus tropicalis

Alignment Length:919 Identity:166/920 (18%)
Similarity:279/920 (30%) Gaps:372/920 (40%)


  Fly     1 MGVKELWGVLTPHCERKPIN--ELRGKKVAIDLAGWVCESL--------NVVDYFVHPRHHLKNL 55
            |||:.||.:|  .|..:|||  .|.||.:|||::.|:.:::        |.:.     ..||..|
 Frog     1 MGVQGLWKLL--ECTGRPINAETLEGKILAIDISIWLNQAVKGARDRQGNAIQ-----NAHLLTL 58

  Fly    56 FFRTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPSKGDKGRSRFN 120
            |.|.|.|::.::.|:||.:|.||.||.|.:|||.                |.:.:..::.:....
 Frog    59 FHRLCKLLFFRIRPIFVFDGEAPLLKRQTLAKRR----------------QRKDNASNEAKKTHE 107

  Fly   121 HVLKQCETLLLSMGIQCV-----QGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGAVRVYRNFS 180
            .:|:   |.|....|:..     |...|..::.....|         :..|.:....:.....:|
 Frog   108 KLLR---TFLKRQAIKAALSGNKQSNDELPSFSKVRRK---------ETDDLYILPPLEDNEKYS 160

  Fly   181 VSTQGAQA----------------AAGGAVDI-----------------YDMREITSRM------ 206
            ...:..:|                |...:|||                 .||:|.|.|.      
 Frog   161 SEEEEERAWEERMTQKQRLQEEFFANPSSVDIESEEFISLPPEVKHEILTDMKEFTKRRRTLFEA 225

  Fly   207 ------DFGQQKIIVMALLCGCDYCPDGIGGIGKDGVLKLFNKYKETEILDRMRSWRG-----ET 260
                  ||.|.::..:......:.|        .|.|.|..|:....|:..:..:..|     ||
 Frog   226 MPEDSNDFSQYQLSGLLKKNNLNKC--------IDNVRKELNQQYSGEVQAQFEAEGGFLKEVET 282

  Fly   261 DK-----------YNALEIRVDDKSICSNCGHIGKTQSHTKSGCSVCRTHKGCDESLWKEQRLSI 314
            .:           ...::.:.::|.:.|      ..||.|.:.....:|:            |.:
 Frog   283 RRLVSEDNSHYILIKGIQSKKEEKKVDS------PPQSVTYNSSQTPKTY------------LDL 329

  Fly   315 KSELTLRRKALLSPDFPNEEIIAEFLSEPDTIPNLNLNWRQPNLVKFIKQIGHLLQWPEIYCFQK 379
            |  |...|||..|.....:|       ||.:                          |.      
 Frog   330 K--LASARKAKSSQAASADE-------EPPS--------------------------PR------ 353

  Fly   380 FFPILTRWQVQQSKQEKILIQPHEIIKKRTVKGVPSLELRWHDPSGIFKGLIPDKQIAEYEAE-H 443
                 |.:.:|::..|.|                  |:..|.|.    |...|...:.|.|.. .
 Frog   354 -----TLFAIQEAMTENI------------------LDENWDDE----KHEKPSVSVREAEGNVS 391

  Fly   444 PKGIEELYYTIEPLDMLETAYPDLVAAFLKSKEKPAKKTTRKKKTASEEENKENEPNSKPKRVVR 508
            |:.::.:|..:                   ::::..:...:|....||.|:|      |.|.:| 
 Frog   392 PRTLQAIYQVL-------------------AEDEAGQSNKKKTVVQSEREHK------KAKVIV- 430

  Fly   509 KIKAQPEENQPLLHQFLGRKKE--GTP-VKAPAPQRQQC-STPITKFLPSDLESDCDAEEFDMSD 569
             |.:..||:..|.:|  ||.|.  |.| :...:|...|| .:.::..|      || |....:|.
 Frog   431 -ISSSDEEDNCLNNQ--GRTKAAFGVPLINRVSPSSVQCQESAVSSVL------DC-AHSRSVSQ 485

  Fly   570 IVKGIISNPNAKPALTNHDGHQLHYE----PMAEDLSLRLAQMSLGN-------------VNESP 617
                 :..|:.:..:.....|.|..:    |:|:|  ..:...|.||             .:|.|
 Frog   486 -----VEEPSNEVNVVEMADHNLQLDNRNVPIAQD--TLIVSSSTGNAENPVTLCNTIPVTSEIP 543

  Fly   618 KVETKRDLSQVDQLPQSKRFSLEDSFDLLVKGDLQK----------------------------- 653
            .:...|.:.:....|.:.. |.:.|.|:.::||..|                             
 Frog   544 LLSVNRSIQKSVINPYNSG-SFDSSRDISLQGDANKQGFSDNPVVDVLNSPFETALKSSSALGES 607

  Fly   654 ----------------------------LARTPVE-RFKMQHRISEKIPTPVKPL---------- 679
                                        |.::|.| ..|....:||...||...|          
 Frog   608 SNTLATQLLLSKSNKFSDPSMGQSCSNTLLKSPFETALKSSSALSESSNTPATQLLLSKSNKYSD 672

  Fly   680 ------------------------------DNISYFFNQSSDNADVFEELMNSSLVPQDQE---D 711
                                          ||.......|:|:..|:..:...|::..|:|   |
 Frog   673 ASMVQGCSNTLEVTQVIQPSAGSEVKQPAEDNPPMKVLGSNDSGGVYVPMTPESIIVSDEEICDD 737

  Fly   712 NAEDEEEDD 720
            ..||.:.||
 Frog   738 KKEDSDSDD 746

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 86/460 (19%)
H3TH_GEN1 210..342 CDD:188625 24/148 (16%)
ercc5XP_012811722.1 rad2 1..1112 CDD:273166 166/920 (18%)
PIN_XPG 1..>120 CDD:189038 42/145 (29%)
PIN_XPG <812..1069 CDD:189038
H3TH_XPG 937..1030 CDD:188624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.