DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13708 and CG8800

Sequence 1:NP_001261433.1 Gene:CG13708 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster

Alignment Length:230 Identity:53/231 (23%)
Similarity:88/231 (38%) Gaps:75/231 (32%)


  Fly   441 SVMTSI-SALEQLSIKNKQLSLSASYGSI-FQ---------------QLVFLDLYDNQIERIANL 488
            |..|:| .||::...:.:|.||:|....: ||               |...:.:..|.||:|..|
  Fly     2 SKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGL 66

  Fly   489 DGLPSLSVLLLGKNRITDIGGLSSLKDTLRVLDLHGNKLTSLGSRINCLQQLKSLNLAGNQIRQI 553
            .|:..|.||.|.:|.|..|.||.::.:||..|.|          ..|.::::|.|.         
  Fly    67 SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWL----------SYNLIEKIKGLT--------- 112

  Fly   554 NQQDFLGLRCLRELNLKRNKLRRINGFQHLVALERLWLCHNDLHRVDDMASIARATRLLEVTIEN 618
                  ||:||:.|.:..|.::..:.|..|..:|.|          :|:            .:..
  Fly   113 ------GLKCLKVLYISNNLIKDWSEFNRLAEIESL----------EDL------------VVVG 149

  Fly   619 NPVS-------LAGDCVSFLVSYLPLLQTLSQMPI 646
            ||:|       ...:|    :..||.::.|...|:
  Fly   150 NPLSEGLDEPTWRAEC----IKRLPTIRKLDGEPV 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13708NP_001261433.1 LRR_RI <428..572 CDD:238064 39/148 (26%)
leucine-rich repeat 449..471 CDD:275380 7/38 (18%)
leucine-rich repeat 472..493 CDD:275380 6/21 (29%)
LRR_8 475..527 CDD:290566 19/52 (37%)
leucine-rich repeat 494..516 CDD:275380 9/22 (41%)
LRR_8 516..574 CDD:290566 13/58 (22%)
leucine-rich repeat 517..539 CDD:275380 4/22 (18%)
leucine-rich repeat 540..563 CDD:275380 4/23 (17%)
LRR_4 564..604 CDD:289563 8/40 (20%)
leucine-rich repeat 564..585 CDD:275380 5/21 (24%)
leucine-rich repeat 611..637 CDD:275380 6/33 (18%)
LRR_9 <1059..1153 CDD:258718
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 48/219 (22%)
leucine-rich repeat 50..71 CDD:275380 6/21 (29%)
leucine-rich repeat 95..116 CDD:275380 8/46 (17%)
leucine-rich repeat 117..141 CDD:275380 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.