DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13711 and CG13716

DIOPT Version :8

Sequence 1:NP_647928.1 Gene:CG13711 / 38576 FlyBaseID:FBgn0035572 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_647920.1 Gene:CG13716 / 38567 FlyBaseID:FBgn0035563 Length:117 Species:Drosophila melanogaster

Alignment Length:75 Identity:20/76 (26%)
Similarity:45/76 (59%) Gaps:0/76 (0%)


  Fly    30 QQQPKGTPNVGYHLYLYRQQLSQKNVEYMRLSKAKYFITDTLLAKTVRNLKGYSADELKTVNHQI 94
            |..|..:|...|.::|:|::|.::.:...|:|..|..:|..|:|:|.:|::..|.::|:.:..:.
  Fly    20 QNSPPKSPTAAYAMFLHREELRRRKLHVSRVSVTKIHLTSELIAQTKQNIRQCSFEDLEILARET 84

  Fly    95 VFRHKLRRQI 104
            :|:..|:|.:
  Fly    85 LFKKNLQRNL 94

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13711NP_647928.1 DUF733 36..120 CDD:283068 18/70 (26%)
CG13716NP_647920.1 DUF733 26..105 CDD:283068 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4967351
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.