DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7514 and ucp2

Sequence 1:NP_647923.1 Gene:CG7514 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_571251.1 Gene:ucp2 ZFINID:ZDB-GENE-990708-8 Length:310 Species:Danio rerio

Alignment Length:289 Identity:89/290 (31%)
Similarity:136/290 (47%) Gaps:24/290 (8%)


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQI----SATTG------EYKSSFDCLLKVFKNEGILALYN 70
            :|..|.|..:......|||..|.|:||    .|:|.      :|:..|..:..:.:.||..:||:
Zfish    17 FIGAGTAACIADLFTFPLDTAKVRLQIQGENKASTNMGRGPVKYRGVFGTISTMVRVEGPRSLYS 81

  Fly    71 GLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAG-AFGAM---FGNPAEVA 131
            ||.|||.||.::.:.|:|.|...     |||....:..|.:|..::|| ..|||   ...|.:|.
Zfish    82 GLVAGLQRQMSFASVRIGLYDSV-----KQFYTKGSDHAGIGSRLMAGCTTGAMAVAVAQPTDVV 141

  Fly   132 LIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAA 196
            .:|..:  ::.....:.|...::|:..|.|:||...||||..|.:.|..|||..:|.:|..:|.|
Zfish   142 KVRFQA--QVSAGSSKRYHSTMDAYRTIAKEEGFRGLWKGTGPNITRNAIVNCTELVTYDLIKDA 204

  Fly   197 F---SEYFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIAS 258
            .   |.....|..|..:|..:|..|||.:.|:|:.|||.......:|...::..:.:...||..:
Zfish   205 LLKSSLMTDDLPCHFTSAFGAGFCTTIIASPVDVVKTRYMNSAQGQYSSALNCAVAMLTKEGPKA 269

  Fly   259 LWKGFTPYLCRLGPHTVFAFIFLEQLTKA 287
            .:|||.|...|||...|..|:..|||.:|
Zfish   270 FYKGFMPSFLRLGSWNVVMFVTYEQLKRA 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 88/288 (31%)
Mito_carr 19..90 CDD:278578 26/81 (32%)
Mito_carr 104..201 CDD:278578 30/104 (29%)
Mito_carr 207..284 CDD:278578 25/77 (32%)
ucp2NP_571251.1 Mito_carr 10..112 CDD:278578 31/100 (31%)
Solcar 1 11..107 30/95 (32%)
PTZ00169 17..300 CDD:240302 89/290 (31%)
Mito_carr 113..209 CDD:278578 29/98 (30%)
Solcar 2 115..204 28/91 (31%)
Solcar 3 213..298 27/85 (32%)
Mito_carr 218..300 CDD:278578 27/82 (33%)
Purine nucleotide binding. {ECO:0000250} 277..299 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.