DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7514 and CG18418

Sequence 1:NP_647923.1 Gene:CG7514 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster

Alignment Length:308 Identity:203/309 (66%)
Similarity:247/309 (80%) Gaps:7/309 (2%)


  Fly     1 MAYSIEKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQISATTG--EYKSSFDCLLKVFKNE 63
            :.|.:|||::|.:|.::.||.:|||.|||||||||:|||||||.|.|  |||:||:.|.||.|||
  Fly     3 LVYGVEKKTVPTHMKFVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNE 67

  Fly    64 GILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPA 128
            |||:|||||||||:||||||:|:||.||||:|.|||.|...|:::|||.|||:|||||||.||||
  Fly    68 GILSLYNGLSAGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPA 132

  Fly   129 EVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQL 193
            |||||||||||||.|.:||||..|.:|||||||||||:.||:||:|||||||:||||||||||.:
  Fly   133 EVALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLM 197

  Fly   194 KAAFSEYFS-GLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKT----AEYKGTMDVLMKVSKN 253
            |.....|.| |:.||:.||::|||||::.|||||||||||||.|.    .||.||:|||.||.||
  Fly   198 KNQLHGYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLKN 262

  Fly   254 EGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIVLGDDSESNI 301
            ||..::||||||||.|:||||:|:|:||||:.|||...:|.|....::
  Fly   263 EGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKAYSKHMLSDSLSDSV 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 193/278 (69%)
Mito_carr 19..90 CDD:278578 55/73 (75%)
Mito_carr 104..201 CDD:278578 71/97 (73%)
Mito_carr 207..284 CDD:278578 54/81 (67%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 67/98 (68%)
PTZ00169 18..296 CDD:240302 193/278 (69%)
Mito_carr 109..205 CDD:278578 71/96 (74%)
Mito_carr 208..300 CDD:278578 59/92 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C292795309
eggNOG 1 0.900 E1_KOG0759
Homologene 1 1.000 H117313
Inparanoid 1 1.050 223 1.000 Inparanoid score I1152
Isobase 1 0.950 0 Normalized mean entropy S777
OrthoDB 1 1.010 D404074at33208
OrthoFinder 1 1.000 FOG0004492
orthoMCL 1 0.900 OOG5_127710
Panther 1 1.100 P PTHR45618
RoundUp 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.