DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7514 and CG18327

Sequence 1:NP_647923.1 Gene:CG7514 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster

Alignment Length:290 Identity:76/291 (26%)
Similarity:137/291 (47%) Gaps:23/291 (8%)


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQIS---ATTGE----YKSSFDCLLKVFKNEGILALYNGLS 73
            ::.||:|.|.......|::::|||:|:.   |..|.    |||.|...:.|.||:|||.|..||:
  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLA 70

  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLA-SMGMGILAGAFGAMFGNPAEVALIRMMS 137
            ..|..|....:.|:..|...::......|......| .|..|.|.|..|:...:|..:...::.:
  Fly    71 PALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQA 135

  Fly   138 D--NRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEY 200
            .  .::....:..:..:.:|..:|.:..||..||:|.:..|.||.:.:.||:|.:.|.|:...| 
  Fly   136 QAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKE- 199

  Fly   201 FSGLSLH-----IAAAMMSGLLTTIASMPLDMAKTRIQQQ------KTAEYKGTMDVLMKVSKNE 254
             :|:..|     ..:.:.:|...::|..|||:..||:..|      :...|:|.:|.::.:.::|
  Fly   200 -NGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSE 263

  Fly   255 GIASLWKGFTPYLCRLGPHTVFAFIFLEQL 284
            |:..|:|||.|...|..|::....:|.::|
  Fly   264 GVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 76/291 (26%)
Mito_carr 19..90 CDD:278578 27/78 (35%)
Mito_carr 104..201 CDD:278578 23/100 (23%)
Mito_carr 207..284 CDD:278578 22/88 (25%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 27/81 (33%)
PTZ00169 5..293 CDD:240302 75/289 (26%)
Mito_carr 101..201 CDD:278578 23/102 (23%)
Mito_carr 204..296 CDD:278578 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2027672
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.