DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and fgfrl1a

DIOPT Version :10

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_956670.1 Gene:fgfrl1a / 393347 ZFINID:ZDB-GENE-040128-2 Length:483 Species:Danio rerio


Alignment Length:104 Identity:26/104 - (25%)
Similarity:39/104 - (37%) Gaps:27/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 RALGPAL-TREINIDDANNLIVFCNNTSDC--------------------GVTPRTQTQPSHTTD 645
            |.|..|| .:|:..|||...|  |..|:..                    |..|..:|:  ::||
Zfish    73 RVLQQALRIKEVEADDAGTFI--CKATNGFGSVNINYTLIVIDDSSAGREGARPAGETE--YSTD 133

  Fly   646 SSPKILRT--TVLTSIRSTVHPRPTSTSTTTSTTTTAPP 682
            .:.|::|.  |....:|..|..||..:|.....|.:..|
Zfish   134 LTGKLVRPRFTQPAKMRKRVIARPVGSSVRLKCTASGNP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581
fgfrl1aNP_956670.1 I-set 32..111 CDD:400151 11/39 (28%)
Ig strand B 42..46 CDD:409390
Ig strand C 55..59 CDD:409390
Ig strand E 77..81 CDD:409390 2/3 (67%)
Ig strand F 91..96 CDD:409390 2/6 (33%)
Ig strand G 104..107 CDD:409390 0/2 (0%)
IgI_2_FGFRL1-like 141..232 CDD:409442 8/32 (25%)
Ig strand A 141..144 CDD:409442 0/2 (0%)
Ig strand A' 152..157 CDD:409442 1/4 (25%)
Ig strand B 161..169 CDD:409442 2/7 (29%)
Ig strand C 175..180 CDD:409442
Ig strand C' 183..185 CDD:409442
Ig strand D 191..194 CDD:409442
Ig strand E 198..203 CDD:409442
Ig strand F 212..219 CDD:409442
Ig strand G 222..232 CDD:409442
Ig 240..348 CDD:472250
Ig strand B 258..262 CDD:409363
Ig strand C 271..275 CDD:409363
Ig strand E 315..319 CDD:409363
Ig strand F 329..334 CDD:409363
Ig strand G 342..345 CDD:409363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.