DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and F40G9.8

DIOPT Version :10

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001367839.1 Gene:F40G9.8 / 185556 WormBaseID:WBGene00018244 Length:273 Species:Caenorhabditis elegans


Alignment Length:45 Identity:12/45 - (26%)
Similarity:20/45 - (44%) Gaps:4/45 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 FSPGDVDVVGDKPTTYRPSGANRPSIAPLNSAQDRERKLMNVLAA 185
            |.|..::.|.|    .:|:.|:.||..|......::..|..:|.|
 Worm   200 FEPMFLETVID----VKPASASAPSEMPFTGGSSKQSLLFYILLA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581
F40G9.8NP_001367839.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.