DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Flt3

DIOPT Version :10

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_034359.2 Gene:Flt3 / 14255 MGIID:95559 Length:1000 Species:Mus musculus


Alignment Length:123 Identity:27/123 - (21%)
Similarity:47/123 - (38%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IKLTGNPIPSWVNRLA-RIGKFSGFMCN------CVLPATINATRFGNNRVN---QDKSCEAENE 177
            :|.|.:.|||.:..:: ..|..  |:.|      .:.||..:...|..|.:.   .|...| ::.
Mouse    39 VKFTPDNIPSEILSVSWHFGDI--FILNGNPDSPLIFPAYEDKVSFDKNTLALELWDLKLE-DSG 100

  Fly   178 KKKLTSVSSRERSTIATPS-------SSSSSPSVQVRGRSRKRRPRALQPSSPLTLGS 228
            ...||.::||..|.....|       ...||.:...:|.......:.::.:|||:..|
Mouse   101 SYSLTVITSRGNSHKGETSLQVFALIEGESSANFTSKGNGNVTSVQWMKDNSPLSSSS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581
Flt3NP_034359.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..67 6/23 (26%)
ig 256..346 CDD:395002
Ig strand B 269..273 CDD:409353
Ig strand C 283..287 CDD:409353
Ig strand E 315..318 CDD:409353
Ig strand F 328..333 CDD:409353
7tm_GPCRs <491..>586 CDD:475119
Protein Kinases, catalytic domain 573..950 CDD:473864
Important for normal regulation of the kinase activity and for maintaining the kinase in an inactive state in the absence of ligand binding. /evidence=ECO:0000250 592..598
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 968..1000
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.