DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7465 and CG11131

DIOPT Version :10

Sequence 1:NP_647909.1 Gene:CG7465 / 38553 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_649429.1 Gene:CG11131 / 40511 FlyBaseID:FBgn0037204 Length:229 Species:Drosophila melanogaster


Alignment Length:295 Identity:119/295 - (40%)
Similarity:152/295 - (51%) Gaps:97/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLF-------LVAFAVIAAVAADVSHL--PSNEYLPPVQEQQIIAGPSNEYLPPVQAESAPAHE 56
            ||||       |||||  ||.:||.:..  ||:||||||.|                   |.|.:
  Fly     1 MKLFTAVLAICLVAFA--AAQSADPAAALEPSSEYLPPVGE-------------------AEAAQ 44

  Fly    57 LADDGYRYKTHKRVVVRRHRRDVNELFNEYLPPFA-APSNEYLAPAEGAP--ETILADDGYRYKT 118
            |:::||:|:|.:|:.: ||||:|..  .|||||.. |||.|||.|.:.|.  :|.:|||||||||
  Fly    45 LSENGYKYRTVRRLKL-RHRREVPN--QEYLPPVENAPSQEYLPPVDAAAIGDTKVADDGYRYKT 106

  Fly   119 HKRVVTR-RHRRDVSHLPSNEYLPPVQAAAPSNEYLPPVSAPVQVAAPAPAPVQIAAPVQLAAPA 182
            .:::..| |||||||.:           |.||.||||||.                  |:||...
  Fly   107 VRKLKFRARHRRDVSEI-----------AEPSGEYLPPVQ------------------VELAPEL 142

  Fly   183 PVVVEAEPAHELADDGYRYKTHRRVVYRRHRRD--VNELSNEYLPPFAAPSNEYLAPAETA---- 241
            ..:        |.||||:|||.||:.:|||||:  ..|.:.|     :||:.|||.|||.|    
  Fly   143 KTI--------LGDDGYKYKTVRRLKFRRHRREAVAEEAAAE-----SAPNGEYLPPAEAAAAAP 194

  Fly   242 ------PE-----TDLAVDGYRYKTHKRVVTR-RH 264
                  |:     |:||.|||||||.:|:..| ||
  Fly   195 AAAEAEPKSAEEGTELAKDGYRYKTVRRLRYRYRH 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7465NP_647909.1 GYR 111..128 CDD:426962 10/17 (59%)
PRK12757 <128..>193 CDD:237191 17/64 (27%)
GYR 249..265 CDD:426962 11/17 (65%)
GYR 305..321 CDD:426962
CG11131NP_649429.1 GYR 47..64 CDD:426962 7/17 (41%)
GYR 99..116 CDD:426962 9/16 (56%)
GYR 212..229 CDD:426962 9/16 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.