DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7465 and CG13033

Sequence 1:NP_647909.1 Gene:CG7465 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_648902.1 Gene:CG13033 FlyBaseID:FBgn0036638 Length:211 Species:Drosophila melanogaster

Alignment Length:278 Identity:74/279 (27%)
Similarity:99/279 (35%) Gaps:101/279 (36%)


  Fly     5 LVAFAVIAA----VAADVSHLPSNEYLPPVQEQQIIAGPSNEYLPPVQAESAPAHELADDGYRYK 65
            |:|...:|:    |..||||||. ||||||:...:   ||.:|||||:                 
  Fly    10 LLAVVSLASCRSVVRRDVSHLPL-EYLPPVELPPV---PSRDYLPPVE----------------- 53

  Fly    66 THKRVVVRRHRRDVNELF---NEYLPPFAAPSNEYLAPAEGAPETILADDGYRYKTHKRVVTRRH 127
                    :|...:|.:.   .:||||.   :||||.|                     ||....
  Fly    54 --------QHAATLNHVLQPPRDYLPPL---NNEYLPP---------------------VVEEEQ 86

  Fly   128 RRDVSHLPSNEYLPPVQAAAPSNEYLPPVSAPVQVAAPAPAPVQIAAPVQLAAPAPVVVEAEPAH 192
            :::|.  .:.|.:.|.:.....     |.:..|.:....|...:|....|.......|.|.||..
  Fly    87 KQEVP--TTTEVIIPEETTTAE-----PTTEAVIITTEQPQEAEIITEPQEEVEVKTVEEEEPEK 144

  Fly   193 E-----LADDGYRYKTHRRVVYRRHRRDVNELSNEYLPPFAAPSNEYLAP------AETAP--ET 244
            |     |.||||.|:|...|                  |...|..|||.|      .|..|  |.
  Fly   145 EVESAVLLDDGYHYRTPSVV------------------PNLLPVKEYLPPLDGNAVVEELPNGEE 191

  Fly   245 D---LAVDGYRYKTHKRV 259
            |   |..|||.|::.||:
  Fly   192 DSSALLDDGYHYRSVKRL 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7465NP_647909.1 GYR 111..128 CDD:128953 2/17 (12%)
GYR 249..265 CDD:128953 6/12 (50%)
CG13033NP_648902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131100200
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.