DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7465 and CG32237

Sequence 1:NP_647909.1 Gene:CG7465 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_729037.1 Gene:CG32237 FlyBaseID:FBgn0052237 Length:911 Species:Drosophila melanogaster

Alignment Length:446 Identity:163/447 (36%)
Similarity:202/447 (45%) Gaps:165/447 (37%)


  Fly     1 MKLFLVAFAVIAAVAA-----------DVSHLPSNEYLPPVQEQQIIAGPSNEYLPPVQAESA-- 52
            |||||....:.||.||           |||.: .|||:||.:|              |.||.|  
  Fly     1 MKLFLACIFIAAATAAVIPVEQARHRRDVSEI-VNEYIPPAEE--------------VGAELAQD 50

  Fly    53 PAHELADDGYRYKTHKRVVVRRHRRDVNELFNEYLPPFA-----APSNEYLAPAEGAPE--TILA 110
            || .|.||||||||.:|:.:|: ||||:|:.||||||..     ||..|  .|.|.|.:  .:||
  Fly    51 PA-ALGDDGYRYKTVRRLKLRQ-RRDVSEIANEYLPPTEEVVADAPVEE--VPVEEASQDSAVLA 111

  Fly   111 DDGYRYKTHKRVVTRRHRRDVSHLPSNEYLPP---VQAAAP------------------------ 148
            .|||:|||.:| :..|.|||||.: :||||||   |.|.||                        
  Fly   112 ADGYQYKTVRR-LKYRQRRDVSDI-ANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYKYK 174

  Fly   149 ----------------SNEYLPPVSAPVQVAAPAPAPVQIAAPVQLAAPAPVVVEAEPAHELADD 197
                            :||||||....|     |..||: ..||:.|:....|        ||.|
  Fly   175 TVRRLKYRQRRDVSEIANEYLPPTEEVV-----ADTPVE-EVPVEEASQDSAV--------LAAD 225

  Fly   198 GYRYKTHRRVVYRRHRRDVNELSNEYLPPFAAPSNEYLAPAETAPETD-------LAVDGYRYKT 255
            ||:|||.||:.||: ||||:|::||||||....:.|  ||.|.||..:       ||.|||:|||
  Fly   226 GYKYKTVRRLKYRQ-RRDVSEIANEYLPPTEDAATE--APIEEAPVEEASQDSAVLAADGYQYKT 287

  Fly   256 HKRVVTRRHRRDVNELSNEYLPP----VQSAP--------------------------------- 283
            .:| :..|.||||:|::||||||    |..||                                 
  Fly   288 VRR-LKYRQRRDVSEIANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYKYKTVRRLKYRQ 351

  Fly   284 -------SAEYLAPQENTVEAAPAH------------VLADDGYVYKTHKRVVLRR 320
                   :.|||.|.|..|..||..            |||.|||.|||.:|:..|:
  Fly   352 RRDVSEIANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYQYKTVRRLKYRQ 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7465NP_647909.1 GYR 111..128 CDD:128953 8/17 (47%)
GYR 249..265 CDD:128953 8/16 (50%)
CG32237NP_729037.1 GYR 56..73 CDD:128953 11/18 (61%)
GYR 168..185 CDD:128953 0/17 (0%)
GYR 224..241 CDD:128953 11/18 (61%)
GYR 336..353 CDD:128953 0/17 (0%)
GYR 448..465 CDD:128953
GYR 616..633 CDD:128953
GYR 728..745 CDD:128953
GYR 892..909 CDD:128953
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131099901
eggNOG 1 0.900 E1_2CKD8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005356
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.