DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7465 and hpo-34

Sequence 1:NP_647909.1 Gene:CG7465 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001263971.1 Gene:hpo-34 WormBaseID:WBGene00009259 Length:1801 Species:Caenorhabditis elegans

Alignment Length:421 Identity:87/422 (21%)
Similarity:142/422 (34%) Gaps:162/422 (38%)


  Fly    17 DVSH----LPSNEYLPPV----QEQQI---------------------IAGPSNEYLPPVQAESA 52
            |.||    |.:::||||:    |::.:                     :.|..:.|:|.||..|:
 Worm  1039 DDSHQKVDLTNHQYLPPIVNAEQKEAVKLYEHQYVPLPPKKDSFAVRKLEGKDHHYVPLVQNYSS 1103

  Fly    53 PAHELADDGYRYKTHKRVVVRRHRRDVNELFNEYLP------------------PFAAP------ 93
            .|.:|..:.:.|....| .|..|::.|:|..| |:|                  |.||.      
 Worm  1104 KAPQLPREHHYYPAPVR-SVEHHQKHVHEQHN-YIPAVHHHETNHQLDRQHGYIPVAAKHEAKKN 1166

  Fly    94 ---SNEYLAPAEGAPETILADDGYRY----KTHKRVVTRRH-RRDVSHLP-------------SN 137
               .::|:.|.....:|...|..:.|    ||.|...|..| .:|..::|             |:
 Worm  1167 VLYEHQYIPPITRTEQTNGYDRRHNYVPVGKTAKATTTDIHVHQDHQYVPQASPRKTISEVNRSH 1231

  Fly   138 EY---LPPVQAAA-----PSNEYLPPVSAPVQVAAPAPAPVQIAAPVQLAAPAPVVVEAEPAHEL 194
            .|   |||.:..:     .|:.||||........:|                 |.::        
 Worm  1232 NYIPALPPKEHQSRHEHYQSHSYLPPSQKSTSHQSP-----------------PKLI-------- 1271

  Fly   195 ADDGYRYKTHRRVVYRRHRRDVNELSNE--YLPPFAA---------PSNEYLAPAETAPETDLAV 248
                    .|..|....|:...|::.:|  |:||...         ..:||| |:....|:.   
 Worm  1272 --------NHSFVPQIPHKTKDNQVVHEHGYVPPVKKSDLKTSVDHSKHEYL-PSVVHTESK--- 1324

  Fly   249 DGYRYKTHKRVVTRRHRRDVNE---LSNEYLPPV-------QSAPSAEYLAPQENTVEAA----- 298
            |.:::..|..|.:..|.:.:..   .::.|:|||       .|.|:.....||....:::     
 Worm  1325 DDFKHSKHGYVPSLEHSQRIERGVVSTHNYVPPVTKIIEKNASDPTKHGYLPQSKRSKSSDQIDH 1389

  Fly   299 ------PA--HVLADD-------GYVYKTHK 314
                  |:  |..|.|       |||..|.|
 Worm  1390 SKHGFLPSIKHQEAQDHADHSRHGYVPPTKK 1420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7465NP_647909.1 GYR 111..128 CDD:128953 7/22 (32%)
GYR 249..265 CDD:128953 4/16 (25%)
hpo-34NP_001263971.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CKD8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.