DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7465 and F11E6.3

Sequence 1:NP_647909.1 Gene:CG7465 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_503116.1 Gene:F11E6.3 WormBaseID:WBGene00008707 Length:345 Species:Caenorhabditis elegans

Alignment Length:394 Identity:111/395 (28%)
Similarity:133/395 (34%) Gaps:137/395 (35%)


  Fly     1 MKLFLVAFAVIAAVAADVSHLPSNEY--------LPPVQEQQIIAGPS--NEYLP-PV-QAESAP 53
            |::.:||..:..|:|..:.....|.|        .....||...|.||  .|..| || |.|:||
 Worm     1 MRIIIVAGLIALALAHPMKRQAQNSYGDEAAPAPAAAAPEQSFAAEPSAPAETAPEPVAQEETAP 65

  Fly    54 AHELADDGYRYKTHKRVVVRRHRRDVNELFNEYLPPFAAPSNEYLAPA---------------EG 103
            .....|.|||.|...:              |.|....|||:.|..|||               |.
 Worm    66 EAPAQDAGYRSKRQAQ--------------NSYGDEAAAPAVEESAPAAEQPVEQAAEPVAQEEA 116

  Fly   104 APETILADDGYRYKTHKRVVTRRHRRDVSHLPSNEYLPPV------QAAAPSNEYLPPVSAPVQ- 161
            |||....|.|||   .||.....:..:.:..|:.|...|.      |||.|..:......||.| 
 Worm   117 APEAPAQDAGYR---SKRQAQNSYGDEAAAAPAVEESAPAAEQPVEQAAEPVAQEEAAPEAPAQD 178

  Fly   162 ---------------VAAPAPAPVQIAAPVQLAAPAPVVVEAEP-AHELA-------DDGYRYKT 203
                           .||.||| |:.:||   ||..||...||| |.|.|       |.|||.| 
 Worm   179 AGYRSKRQAQNSYGDEAAAAPA-VEESAP---AAEQPVEQAAEPVAQEEAAPEAPAQDAGYRSK- 238

  Fly   204 HRRVVYRRHRRDVNELSNEYLPPFAAPSNEYLAPA---------------ETAPETDLAVDGYRY 253
                     |:..|...:|   ..|||:.|..|||               |..||......|||.
 Worm   239 ---------RQAQNSYGDE---AAAAPAVEESAPAAEQPVEQAAEPVAQEEAVPEAPAQDAGYRS 291

  Fly   254 KTHKRVVTRRHRRDVNELSNEYLPPVQSAPSAEYLAP--------------QENTVEAAPAHVLA 304
            |              .:..|.|.....:||:||..||              ||.|...|||.   
 Worm   292 K--------------RQAQNSYGDEAAAAPAAEESAPAAEQPVEQAAEPVAQEETAPEAPAQ--- 339

  Fly   305 DDGY 308
            |.||
 Worm   340 DAGY 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7465NP_647909.1 GYR 111..128 CDD:128953 6/17 (35%)
GYR 249..265 CDD:128953 4/16 (25%)
F11E6.3NP_503116.1 rne <65..237 CDD:236766 57/193 (30%)
PRK07994 <157..341 CDD:236138 62/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.