DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7465 and K08D12.6

Sequence 1:NP_647909.1 Gene:CG7465 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_741325.1 Gene:K08D12.6 WormBaseID:WBGene00019540 Length:668 Species:Caenorhabditis elegans

Alignment Length:342 Identity:93/343 (27%)
Similarity:113/343 (33%) Gaps:138/343 (40%)


  Fly    29 PVQEQQI-------IAGPSNEYLPPVQAESAPAHELADDGYRYKTHKRVVVRRHRRDVNELFNEY 86
            ||::..:       .|.|:.:......|.:|||....|.|||.|.                 |.|
 Worm   178 PVEQAPVAVPAPAPAAAPAPDCGSAAPAPAAPAPAATDSGYRSKR-----------------NSY 225

  Fly    87 ---------------------------LP---PFAAPSNE--YLAPAEGAPETILADDGYRYKTH 119
                                       :|   |.|||..|  ..|||..|......|.|||.|.:
 Worm   226 GDEQVTPAPAAAAPAPADAPVEQAPVAVPAPAPVAAPDVECGSAAPAPAAAAPAATDSGYRSKRN 290

  Fly   120 KRVVTRRHRRDVSHLPSNEYLPPVQAAAPSNEYLPPVSAPVQ---VAAPAPAPVQIAAP-VQLAA 180
            ..              .:|.:.|..||||:     |..|||:   ||.|||||....|| ...||
 Worm   291 SY--------------GDEQVTPAPAAAPA-----PADAPVEQAPVAVPAPAPAAAPAPDCGSAA 336

  Fly   181 PAPVVVEAEPAHELADDGYRYKTHRRVVYRRHRRDVNELSNEYLPPFAAPSNEYLAPAE------ 239
            |||.   |.||  ..|.|||.|.             |...:|.:.|  ||:....|||:      
 Worm   337 PAPA---AAPA--ATDSGYRSKR-------------NAYGDEQVTP--APAAAAEAPADAPVEQA 381

  Fly   240 ----------TAPETD------LAVD-GYRYKTHKRVVTRRHRRDVNELSNEYLPPVQSAPSAEY 287
                      .||..|      .|.| |||.|.             |...:|.:.|   ||:|..
 Worm   382 PVAVPAPAPTAAPAPDCGSAAPAATDSGYRSKR-------------NAYGDEQVTP---APAAAA 430

  Fly   288 LAPQENTVEAAPAHVLA 304
            .||.:..||.||..|.|
 Worm   431 EAPADAPVEQAPVAVPA 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7465NP_647909.1 GYR 111..128 CDD:128953 5/17 (29%)
GYR 249..265 CDD:128953 5/17 (29%)
K08D12.6NP_741325.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.