DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and LOC798522

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_001338964.6 Gene:LOC798522 ID: Length:488 Species:Danio rerio

Alignment Length:519 Identity:170/520 (33%)
Similarity:275/520 (53%) Gaps:62/520 (12%)


  Fly     6 KSWLLCSILVLVAFSLVSASEDEE-----RLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLI 65
            :.|:  .:::|.|..|..||...:     :|:.||...|:..:|||.:..:.:.|...:...|:.
Zfish     5 RRWM--EVMLLSALLLAEASHCAQGRFAHKLLNDLMEDYSSALRPVDDTDKSLNVTLQVTLSQIK 67

  Fly    66 NVNEKNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKS 130
            :::|:||::.:.:|:|.||:|..|:|.:.||.|:.|:|:|...:|:||:||:|.||.::.....:
Zfish    68 DMDERNQVLIAYLWIRQVWHDAHLKWSKEDYDGLEVIRIPSSLIWRPDLVLYNKADDDFSGPVDT 132

  Fly   131 NVLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSD 195
            ||::..|||:.|..|||.:|||.:||:|||||.|.|.:.|||||:||:||.:|:.:...  ||||
Zfish   133 NVVLRYTGEITWDAPAITKSSCVVDVSYFPFDSQQCNLTFGSWTYNGNQVDIAMGSVSG--DLSD 195

  Fly   196 YWKSGTWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYL 260
            :.::..|:...:||..||...........|||:.::::|::.||.:||:||..|||||..|.|||
Zfish   196 FVENVEWECHGMPATKNVIMYGCCSDPYPDITYTVLLQRRSSFYIINLLLPCFLISFLAPLSFYL 260

  Fly   261 PAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNF 325
            ||::||||:||:::||:|.||.::|::.:||:..| ||||||.:.|..|.|.|..:|:.|:|.:|
Zfish   261 PADSGEKVSLGVTVLLALTVFQMMVAESMPPSESV-PLIAKYYIATMTMITASTALTIFIMNIHF 324

  Fly   326 RGPRTHRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMP---AHPHPSYGSPAELPKH 387
            .|.....:|.:.:.:.:.|:....|:....::          .:.|   |....|:.|.....||
Zfish   325 CGAEAKPVPYWAKVLIIDYMSKIFFVYEVGES----------CASPFGQAEESESFHSQNHHRKH 379

  Fly   388 ISAIGGKQSKMEVMELSDLHHPNCKINRKVNSGGELGLGDGCRRESESSDSILLSPEA------- 445
                             .||||..||:         |....|..|...|..:|.....       
Zfish   380 -----------------KLHHPKGKIS---------GSPPPCCPEDHKSPFVLGCESCVYCGFRS 418

  Fly   446 ------SKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILMDAP 503
                  :|....||:||...|.:........:||.||.|:||..::||||:....::.|:..||
Zfish   419 GNLACDTKLLRNVEYIANCFREQKTTALKVAEWKKVAKVMDRFFMWIFFIMVFLMSILIIGKAP 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 168/513 (33%)
Neur_chan_LBD 28..236 CDD:280998 77/213 (36%)
Neur_chan_memb 243..498 CDD:280999 81/271 (30%)
LOC798522XP_001338964.6 Neur_chan_LBD 32..477 CDD:332142 161/484 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.