DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and lgc-24

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001123110.2 Gene:lgc-24 WormBaseID:WBGene00045385 Length:389 Species:Caenorhabditis elegans

Alignment Length:346 Identity:79/347 (23%)
Similarity:132/347 (38%) Gaps:68/347 (20%)


  Fly    13 ILVLVAFSLVSASEDEE------RLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKN 71
            :||:....:||..|..:      :|..|||:.||..:...:....:......:.|:..|  ::.:
 Worm     7 VLVIHIHLVVSQWETGKSFTVLTKLRSDLFKNYNGSMPVGKGEYLEATPSLEVGFIHFI--DDDH 69

  Fly    72 QIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKV---------WKPDIVLFNNADGNYEVR 127
            ..|...:...|.|.|.:|:|:.|:|.|:   |...:|.         |.| ||.:.    :|:.|
 Worm    70 GFMSVVINAELTWIDERLKWNPANYSGV---REIVEKTFEFRKDNNCWMP-IVKYR----SYDRR 126

  Fly   128 YK---------SNVLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTC-IMKFGSWTFNGDQ--- 179
            |.         :..||...||:......:..:.|......:|.|.|.| ||...:.  |.|:   
 Worm   127 YSELDLLEFSDARTLISYKGEIKTALQTMVTTKCQFSFGEYPNDYQNCSIMLIPNQ--NADEFRF 189

  Fly   180 VSLALYNNKNFVDLSDYWKSGTWDIIEVPAYLNVYEGDSN------------HPTETDITFYIII 232
            ||...|.|..|.:| ::......|:..:....|::...:|            :..:|:..|.::.
 Worm   190 VSPNGYCNPKFENL-EHRAVRVHDLHLMGVESNIFYTFANTYFTAEEVTGFEYMAKTEFRFNLMF 253

  Fly   233 RRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFL------LLVSKILPP 291
            :|......|.|.:|::|||...::....|.        |.||......|.      |.||||||.
 Worm   254 KRVNKLLNVKLSIPSILISMFLIIAGLFPN--------GYSIFGYAYCFFVEVMHGLYVSKILPN 310

  Fly   292 TSLVLPLIAKYLLFTFIMNTV 312
            ....:|.... |...|::.||
 Worm   311 DIRGIPYHGA-LALCFLIETV 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 79/347 (23%)
Neur_chan_LBD 28..236 CDD:280998 51/248 (21%)
Neur_chan_memb 243..498 CDD:280999 22/77 (29%)
lgc-24NP_001123110.2 Neur_chan_LBD 29..>178 CDD:280998 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.