DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and htr3b

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_021324909.1 Gene:htr3b ZFINID:ZDB-GENE-071012-4 Length:369 Species:Danio rerio

Alignment Length:386 Identity:106/387 (27%)
Similarity:178/387 (46%) Gaps:58/387 (15%)


  Fly     9 LLCSILVLVAFSLVSASEDEER-----LVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVN 68
            ||.|:|:.|........|..:|     |.|.|.|.||..:|||||.|:...:...|....:::|:
Zfish     5 LLLSLLLSVIPLAELVPEKPKRSALNQLTRLLLRKYNCGVRPVQNWTKPTTIYIDLIIQAVLDVD 69

  Fly    69 EKNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVL 133
            .:.|.:.:::|.|.:|.|..|.||..::.||..:.|..|.:|.||:::....|..     ||.|:
Zfish    70 GQTQKVTTSIWYRQIWNDEFLVWDPDEFDGITEISLSSDAIWVPDLIISEFVDVG-----KSPVI 129

  Fly   134 IYP----TGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFV--D 192
            .|.    :|:|....|....|:|.:::..||||:|.|.:.|.||..:..:|.|||:.....:  |
Zfish   130 PYVYVNCSGKVKNYKPIQVVSACHLEIYAFPFDKQNCTLTFRSWLHSVSEVDLALWRPAEEIAND 194

  Fly   193 LSDYWKSGTWDIIEVPA---YLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLC 254
            ..::...|.|:::.||:   .||:.:.|     ...|.|.::|||:.|.|.|.|::|::.:..:.
Zfish   195 TREFMNDGEWELLGVPSRYWTLNLEDRD-----YAQIQFNVLIRRRPLLYVVGLLIPSIFLMVVD 254

  Fly   255 VLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVI 319
            |:.||||..:|.::|...||||...|..:.:...:|.|::..|||..:......:..:|:.:::.
Zfish   255 VISFYLPPNSGTRITFKTSILLGYTVIRVNLMDEIPATAIKTPLIGVFFAICMALLLLSLAMSIF 319

  Fly   320 IINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGS 380
            ::.                  .|||..                .|:..|||.|.....|||
Zfish   320 VVK------------------LLHYSE----------------KEVKEMSMSACLLDKYGS 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 106/387 (27%)
Neur_chan_LBD 28..236 CDD:280998 66/222 (30%)
Neur_chan_memb 243..498 CDD:280999 31/139 (22%)
htr3bXP_021324909.1 Neur_chan_LBD 26..>325 CDD:332142 90/327 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.