DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and chrnb2

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_005169811.1 Gene:chrnb2 ZFINID:ZDB-GENE-070821-3 Length:543 Species:Danio rerio

Alignment Length:534 Identity:220/535 (41%)
Similarity:303/535 (57%) Gaps:53/535 (10%)


  Fly     8 WLLCSILVLVAFSLVSASEDEERLVRDLFR--GYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEK 70
            |.|..||.:|....  .::.|||||..|..  .|||||||..|.::.|.|:..::..|||:|:|:
Zfish     5 WTLFCILAIVKSGY--GADTEERLVEHLLNPAHYNKLIRPATNGSEVVTVQLMVSLAQLISVHER 67

  Fly    71 NQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIY 135
            .|||.:||||...|.||:|.|...::.|:..:|||...:|.||:||:|||||.|||.:.||.::.
Zfish    68 EQIMTTNVWLTQEWQDYRLTWSPEEFDGMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVS 132

  Fly   136 PTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSG 200
            ..|.|.|:|||||:|:|.|:|.:||||||.|.:.|.|||::..:|.|.|  ..:...:.|:..||
Zfish   133 YDGSVFWLPPAIYKSACKIEVKHFPFDQQNCTLSFRSWTYDRTEVDLVL--RADVASMDDFTPSG 195

  Fly   201 TWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAG 265
            .||||.:|...|....|   ||..|||:..|||||.||||:|||:|.|||:.|.:||||||::.|
Zfish   196 EWDIIALPGRRNENPSD---PTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCG 257

  Fly   266 EKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRT 330
            ||:||.||:||:|.|||||:|||:|||||.:||:.|||:||.::.|.||:.:|.::|.:.|.|.|
Zfish   258 EKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTT 322

  Fly   331 HRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGSPAELPKHISAIGGKQ 395
            |.||.:::.:||:.|||.|||::||.:..|..:.....:.........|..|.|...:...|...
Zfish   323 HTMPPWVKLVFLNKLPALLFMRQPRNSSERQRLRQRRRANEQQEGGRGGLAAGLMAGLGLSGSSS 387

  Fly   396 SKMEVMELSDLHHPNCKINRK--VNSGGELGLGDGCRRESESSDSI------------------- 439
            ...|..|..     .|.:||.  ...|.|||.|.|....::..:.|                   
Zfish   388 GSKENNEAC-----TCYVNRASVKQFGAELGGGGGGGGSTDGLNGIREGGRETREGGANPLQGSA 447

  Fly   440 ---------------LLS---PEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYI 486
                           ||:   |...:|.:.|.|||.|:::||......|||||||||||||.|:|
Zfish   448 LPRGKQQPPTVLTQALLAQACPGFEEAVDGVRFIANHMKSEDDDRSVSEDWKYVAMVIDRLFLWI 512

  Fly   487 FFIVTTAGTVGILM 500
            |..|...||:|:.:
Zfish   513 FVFVCVFGTIGMFL 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 220/533 (41%)
Neur_chan_LBD 28..236 CDD:280998 98/210 (47%)
Neur_chan_memb 243..498 CDD:280999 112/294 (38%)
chrnb2XP_005169811.1 LIC 4..526 CDD:273305 220/533 (41%)
Neur_chan_LBD 23..228 CDD:280998 98/210 (47%)
Neur_chan_memb 235..525 CDD:280999 112/295 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.797 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.