DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and chrna4b

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001041528.1 Gene:chrna4b ZFINID:ZDB-GENE-090505-3 Length:627 Species:Danio rerio

Alignment Length:613 Identity:238/614 (39%)
Similarity:326/614 (53%) Gaps:122/614 (20%)


  Fly     8 WLLCSILVLV-AFSLVSA-SEDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEK 70
            :|||..|.|. .||:..| :..||||::.||..||||.|||.|::..|.|.|||:..|||:|:||
Zfish     9 FLLCVHLQLAYVFSMSPAHAHAEERLLQSLFINYNKLSRPVANISDVVLVHFGLSIAQLIDVDEK 73

  Fly    71 NQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIY 135
            ||:|.:|||::..|.||:|:|:..:|..:..:|:|.:.:|:|||||:|||||::.|.:.:...::
Zfish    74 NQMMTTNVWVKQEWNDYKLRWNPEEYENVTSIRIPSEIIWRPDIVLYNNADGDFAVTHLTKAQVF 138

  Fly   136 PTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSG 200
            ..|.:.|.|||||:|||:||||:||||||.|.|||||||:  |:..:.|.:..:.||..|||:||
Zfish   139 YNGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTY--DRAKIDLISMASDVDQMDYWESG 201

  Fly   201 TWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAG 265
            .|.||......|:.:.:.......|||:..||||..||||:|||:|.:|||.|.|||||||:|..
Zfish   202 EWVIINAVGTYNIKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECA 266

  Fly   266 EKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRT 330
            ||:||.||:||||.|||||:::|:|.||||:|||.:|||||.|..|:||::||.::|.:.|..||
Zfish   267 EKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRT 331

  Fly   331 HRMPMYIRSIFLHYLPAFLFMKRPRKT------RLRWMMEMPGMSM------------PAHPHPS 377
            |.||.::|.:|||.:|.:||||||..:      :|..||.....|.            |..|.|.
Zfish   332 HSMPHWVRQLFLHLVPRYLFMKRPPASGKRNCGKLIEMMHKQANSQSMFLRNNILDISPQSPIPH 396

  Fly   378 YG--SPAE---------LPKHISAIGGKQSKMEVMELSDLHHP-------NCKINRKVNSGG--- 421
            .|  |.|:         .||.:.......|:..:::..:...|       .|.....:.:..   
Zfish   397 LGPTSAAQQDQVQQDSTSPKPLFFCSSPSSQYSILQEENSQTPQTPVLSYTCAYTNSIFASSTTS 461

  Fly   422 --------------------------------------ELGLGDG-------------------- 428
                                                  |..||.|                    
Zfish   462 FPDTLLGTLLHTIPQDGAKSTECDFQGHSAESVFMEAKESVLGAGSCQHCLTSEGTSLQKLDLDE 526

  Fly   429 ---CRRE--------SESSDSIL----------LSPEASKATEAVEFIAEHLRNEDLYIQTREDW 472
               |.|.        |.|||...          ||....||.|.|::||:|||.||.....||||
Zfish   527 AGRCTRHNMPSAQIFSPSSDGSTDLNAAEPVSNLSQSLLKALEGVQYIADHLRAEDSDFSVREDW 591

  Fly   473 KYVAMVIDRLQLYIFFIVTTAGTVGILM 500
            |||||||||:.|::|.:|...||||:.:
Zfish   592 KYVAMVIDRIFLWMFVLVCILGTVGLFL 619

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 238/612 (39%)
Neur_chan_LBD 28..236 CDD:280998 99/208 (48%)
Neur_chan_memb 243..498 CDD:280999 126/373 (34%)
chrna4bNP_001041528.1 Neur_chan_LBD 31..237 CDD:280998 99/208 (48%)
Neur_chan_memb 244..618 CDD:280999 126/374 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H592
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.787 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.