DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and Chrnb2

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_062170.1 Gene:Chrnb2 RGDID:2350 Length:500 Species:Rattus norvegicus

Alignment Length:522 Identity:216/523 (41%)
Similarity:296/523 (57%) Gaps:87/523 (17%)


  Fly    14 LVLVAFSL------VSASEDEERLVRDLF--RGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEK 70
            :.|.:|||      |..::.|||||..|.  ..|||||||..|.::.|.|:..::..|||:|:|:
  Rat     8 MALFSFSLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHER 72

  Fly    71 NQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIY 135
            .|||.:||||...|.||:|.|...|:..:..:|||...:|.||:||:|||||.|||.:.||.::.
  Rat    73 EQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVS 137

  Fly   136 PTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSG 200
            ..|.:.|:|||||:|:|.|:|.:||||||.|.|||.|||::..::.|.|  ..:...|.|:..||
  Rat   138 YDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVL--KSDVASLDDFTPSG 200

  Fly   201 TWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAG 265
            .||||.:|...|....||   |..|||:..|||||.||||:|||:|.|||:.|.:||||||::.|
  Rat   201 EWDIIALPGRRNENPDDS---TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCG 262

  Fly   266 EKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRT 330
            ||:||.||:||:|.|||||:|||:|||||.:||:.|||:||.::.|.||:.:|.::|.:.|.|.|
  Rat   263 EKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTT 327

  Fly   331 HRMPMYIRSIFLHYLPAFLFMKRPR------KTRLR------------WMMEMPGMSMPAHPHPS 377
            |.|..:::.:||..||..||:::||      :.|||            :..|.|.    |.|...
  Rat   328 HTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGALFFREGPA----ADPCTC 388

  Fly   378 YGSPAELPKHISAIGGKQSKMEVMELSDLHHPNCKINRKVNSGGELGLGDGCRRESESSDSILLS 442
            :.:||.:.                                      ||....|.|..::     .
  Rat   389 FVNPASVQ--------------------------------------GLAGAFRAEPTAA-----G 410

  Fly   443 PEAS---------KATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGI 498
            |..|         :|.:.|.|||:|:|:||.....||||||||||||||.|:||..|...||||:
  Rat   411 PGRSVGPCSCGLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTVGM 475

  Fly   499 LM 500
            .:
  Rat   476 FL 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 216/521 (41%)
Neur_chan_LBD 28..236 CDD:280998 99/210 (47%)
Neur_chan_memb 243..498 CDD:280999 107/282 (38%)
Chrnb2NP_062170.1 LIC 28..477 CDD:273305 211/501 (42%)
Neur_chan_LBD 28..233 CDD:280998 99/210 (47%)
Neur_chan_memb 240..476 CDD:280999 107/283 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.787 Consistency score
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.