DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and HisCl1

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_731632.1 Gene:HisCl1 FlyBaseID:FBgn0037950 Length:426 Species:Drosophila melanogaster

Alignment Length:355 Identity:75/356 (21%)
Similarity:134/356 (38%) Gaps:90/356 (25%)


  Fly    39 YNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLR 103
            |:|...| :.:.|...|.|.:..:.|.::||::....::::|...|.|.:             ||
  Fly    67 YDKNRAP-KLLGQPTVVYFHVTVLSLDSINEESMTYVTDIFLAQSWRDPR-------------LR 117

  Fly   104 LPPD--------------KVWKPDIVLFNNA----------DGNYEVRYKSNVLIYPTGEVLWVP 144
            ||.:              .:|:|| ..|.||          ..:|...|....|:|.:...|.: 
  Fly   118 LPENMSEQYRILDVDWLHSIWRPD-CFFKNAKKVTFHEMSIPNHYLWLYHDKTLLYMSKLTLVL- 180

  Fly   145 PAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSGTWDIIEVPA 209
                  ||.:....:|.|.|.|.|...|.:...:             ||...|......::....
  Fly   181 ------SCAMKFESYPHDTQICSMMIESLSHTVE-------------DLVFIWNMTDPLVVNTEI 226

  Fly   210 YLNVYEGDSNHPTE----------TDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEA 264
            .|...:..:|:.|:          |.:.....:||:..::..:..:|:.||..:..:.|::..||
  Fly   227 ELPQLDISNNYTTDCTIEYSTGNFTCLAIVFNLRRRLGYHLFHTYIPSALIVVMSWISFWIKPEA 291

  Fly   265 -GEKVTLGISILLSLVVFLLLVSKILPPTSLVLPL---IAKYLLFTFIMNTVSILVTVIIINWNF 325
             ..:||||::.||:|........:.|||.|.|..:   ::...:|.|:.     |:...::| ||
  Fly   292 IPARVTLGVTSLLTLATQNTQSQQSLPPVSYVKAIDVWMSSCSVFVFLS-----LMEFAVVN-NF 350

  Fly   326 RGP-RTHRMPMY----------IRSIFLHY 344
            .|| .|..|..|          ::|...|:
  Fly   351 MGPVATKAMKGYSDENISDLDDLKSALQHH 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 75/356 (21%)
Neur_chan_LBD 28..236 CDD:280998 44/231 (19%)
Neur_chan_memb 243..498 CDD:280999 31/118 (26%)
HisCl1NP_731632.1 Neur_chan_LBD 67..262 CDD:280998 44/230 (19%)
Neur_chan_memb 270..>350 CDD:280999 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.