DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and chrnd

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_996947.1 Gene:chrnd ZFINID:ZDB-GENE-030131-6665 Length:518 Species:Danio rerio

Alignment Length:549 Identity:206/550 (37%)
Similarity:307/550 (56%) Gaps:77/550 (14%)


  Fly     6 KSWLLCSILVLVAFSLVSASEDEERLVRDLF--RGYNKLIRPVQNMTQKVGVRFGLAFVQLINVN 68
            |:.||.:.|:...|.......:||||:..||  |||||.:|||||..:.|.:...|....||::.
Zfish     3 KTVLLTASLLCFIFQECCGRNEEERLINYLFKERGYNKELRPVQNKDETVDIYLALTLSNLISLK 67

  Fly    69 EKNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVL 133
            |.::.:.:|||:...|.|::|.|:|::| .|.||||||..||.|:|||.||.|..::|.|..|||
Zfish    68 EVDETLLTNVWMEHGWKDHRLTWNESEY-DIPVLRLPPSMVWLPEIVLENNNDAQFQVAYYCNVL 131

  Fly   134 IYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLAL---YNNKNF----- 190
            ||.:|::.|:||||::|||:|:|.|||||.|.|.:||.|.|:|..::||.|   ..|..:     
Zfish   132 IYSSGDMYWLPPAIFRSSCSINVNYFPFDWQNCSLKFSSLTYNAKEISLNLKMEQENTTYYKVEW 196

  Fly   191 --VDLSDYWKSGTWDIIEVPAYLNVYEG---DSNHPTETDITFYIIIRRKTLFYTVNLILPTVLI 250
              :|...:.::|.|:|:..||..|:|:.   :||  ...|||||:||:||.|||.||:|:|.|||
Zfish   197 IIIDPEGFTENGEWEIVHKPARRNIYKSIPKESN--KHQDITFYLIIKRKPLFYIVNIIIPCVLI 259

  Fly   251 SFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSIL 315
            |||..||:||||::|||:||.||:||:..|||||:|:.||.||:.:|||.|||:|..::.||.:|
Zfish   260 SFLASLVYYLPADSGEKMTLSISVLLAQSVFLLLISQRLPETSMAVPLIVKYLMFIMVLVTVVVL 324

  Fly   316 VTVIIINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGS 380
            ..||::|.:||.|.||.|..:.:..||..||..|.                 ||:|....|.  .
Zfish   325 NCVIVLNLHFRTPSTHVMTEWTKEFFLERLPRLLH-----------------MSLPVEDQPV--P 370

  Fly   381 PAELPKHISAIG---------GKQSKMEVM--ELSDLH----HPNCKINRKVNSGGELGLGDGCR 430
            .:.||:..|::|         ..:|:.|:|  :.|:.|    .|..|.....::           
Zfish   371 ESALPRRSSSLGYIAQAEEYYSVKSRSELMFEKQSERHGLAARPTPKATYTSSN----------- 424

  Fly   431 RESESSDSILLSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGT 495
             :||.|:.  |..|...|.|...:|.:|:.:::.|.:.:::|..:|..:|||..|:...|...||
Zfish   425 -DSEVSEQ--LYNEMKPAVEGANYIVKHMHDKNDYNEEKDNWSGIARTVDRLCFYVVTPVMMIGT 486

  Fly   496 VGILMDA-----PHI------FEYVDQDR 513
            :.|.:.|     |.:      |.|.:::|
Zfish   487 ICIFLMANYNQPPALPFQGDPFSYTEENR 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 200/522 (38%)
Neur_chan_LBD 28..236 CDD:280998 99/223 (44%)
Neur_chan_memb 243..498 CDD:280999 91/270 (34%)
chrndNP_996947.1 LIC 6..493 CDD:273305 200/523 (38%)
Neur_chan_LBD 25..245 CDD:280998 99/223 (44%)
Neur_chan_memb 252..490 CDD:280999 92/271 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.790 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.