DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and lgc-29

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001317792.1 Gene:lgc-29 WormBaseID:WBGene00044528 Length:398 Species:Caenorhabditis elegans

Alignment Length:364 Identity:80/365 (22%)
Similarity:149/365 (41%) Gaps:64/365 (18%)


  Fly    28 EERLVRDLFRGYNKLIR--------PVQNMT---QKVGVRFGLAFVQLINVNEKNQIMKSNVWLR 81
            ::||...||:.|:..|.        |..|.|   .:..:...|:.::|:.|.|..:........|
 Worm    38 QDRLFEKLFKSYDPGINAIYTLHSVPETNGTVHPPRFEITIQLSMMKLVEVVEPEEKATFLFDYR 102

  Fly    82 LVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVL---FNNADGNYEVRYKSNVLIYPTGEVLWV 143
            ..|||.:|.||..|||||..:.:|..|||.|:..:   |::....::..|.....::..|.:...
 Worm   103 ADWYDTRLSWDPEDYGGINHIYVPRSKVWIPETTIVDCFSSEIKVFDNEYTRYAWLHSNGSIGMY 167

  Fly   144 PPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSGT------- 201
            ..::....|.:||..||.|..||.:.|...|:..::.::.             .|:||       
 Worm   168 IASVTSVVCQMDVYKFPMDTHTCSVNFLFMTYQLEEFTIV-------------GKTGTLPRPVEQ 219

  Fly   202 -----WDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLP 261
                 |.:..:.........:..:.|:.:.||    .|...||.|.:::|...|:.|.::..::.
 Worm   220 LGNGEWQMKSIQIAFEPVVDNLTYLTKFEATF----SRNPGFYIVLVMIPAYFINVLSIVALFMD 280

  Fly   262 A-EAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVII----- 320
            . ...||.|:|::.::|:...|:::::.||.|. .||::|.|.:.:..:...|:...|.:     
 Worm   281 INNRSEKFTVGMTNIMSMSFILVILAEDLPKTK-NLPILAIYTVTSLAIMLCSLTAVVALPKLKA 344

  Fly   321 ------------INWNFRGPRT--HRMPMYIRSIFLHYL 345
                        |..|...|||  .|:..|.:..::..|
 Worm   345 YYANRSLARGEKIPKNDEVPRTFWERIKFYFKVEYVFML 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 80/365 (22%)
Neur_chan_LBD 28..236 CDD:280998 51/234 (22%)
Neur_chan_memb 243..498 CDD:280999 26/124 (21%)
lgc-29NP_001317792.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.