DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and lgc-8

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001023533.2 Gene:lgc-8 WormBaseID:WBGene00013338 Length:438 Species:Caenorhabditis elegans

Alignment Length:498 Identity:112/499 (22%)
Similarity:211/499 (42%) Gaps:102/499 (20%)


  Fly    10 LCSILVLVAFSLVSASEDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIM 74
            |.|:|:|.....:......|:|...|..||:..||||.|....:.:...:..:..:.::...:.:
 Worm    10 LHSVLILWNLLEIDGITVSEQLKDVLMEGYDSSIRPVINERDTLFINISINSMSFLTLDPAEETI 74

  Fly    75 KSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNY---------EVRYKS 130
            ..:....|.|.|..|.|:::|| .|..|:|....:|.||..:..:.|.||         .|:|..
 Worm    75 NFSGEFILQWKDEFLFWNKSDY-NITWLKLKESFLWTPDTTVSTSIDTNYLIETSERYVSVKYDG 138

  Fly   131 NVL--IYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDL 193
            .|.  ||          |::.:.|.:::..||:|||||::|.|.|::...:|:..:..:....:.
 Worm   139 TVRQNIY----------AVFTNLCDMNINEFPYDQQTCMIKMGPWSYTMKEVTCIVGGDIERNET 193

  Fly   194 SDYWKSGT-WDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLV 257
            :..::..: ||...:.:.:...|....:.|.:::.|.:.::|:..||...|::||.:|:.:|:..
 Worm   194 TGKFQGNSEWDFEGIVSSVGETEDPDVNFTFSEVHFALTVKRRPQFYVWVLLIPTYIITVVCIFG 258

  Fly   258 FYLP-AEAG---EKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTV 318
            .:.| |..|   |:|.|||:.|||..|.|.:|:..:|.|| .|||:..::|....:..:.:|..|
 Worm   259 LFTPTANHGLREERVNLGITTLLSSAVILQIVANAMPKTS-ELPLLGNFILAEIFVVAIGVLFAV 322

  Fly   319 IIINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGSPAE 383
            :::..:.|.......|           ||::.          |::.|.            ||...
 Worm   323 LVLTLHQRAHTREWRP-----------PAWML----------WILRMT------------GSSKF 354

  Fly   384 LPKHISAIGGKQSKMEVMELSDLHHPNCKINRKVNSGGELGLGDGCRRESESSDSILLSPEASKA 448
            |.::|:.|..|.|..|     .:|:                .|:|         :.|.    ...
 Worm   355 LSRNITKIRHKSSTAE-----RIHY----------------TGEG---------AYLF----KNL 385

  Fly   449 TEAVEFIAEHLRNEDLYIQTREDWKYVAMV--IDRLQLYIFFI 489
            .|:::.:.|:::.||     |:.::.:..|  .|||...:..|
 Worm   386 DESLQSVREYIQEED-----RDYFRELTYVKFFDRLDFLLLLI 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 112/499 (22%)
Neur_chan_LBD 28..236 CDD:280998 50/220 (23%)
Neur_chan_memb 243..498 CDD:280999 56/254 (22%)
lgc-8NP_001023533.2 Neur_chan_LBD 29..237 CDD:280998 50/219 (23%)
Neur_chan_memb 244..>348 CDD:280999 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.