DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and Chrne

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_017452660.1 Gene:Chrne RGDID:2353 Length:547 Species:Rattus norvegicus

Alignment Length:502 Identity:167/503 (33%)
Similarity:266/503 (53%) Gaps:51/503 (10%)


  Fly    23 SASEDEE-RLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLVWYD 86
            |..::|| .|...||..|:...|||:.....|.:...:....||::|||.:.:.::||:.:.|.|
  Rat    71 SQGKNEELSLYHHLFDNYDPECRPVRRPEDTVTITLKVTLTNLISLNEKEETLTTSVWIGIEWQD 135

  Fly    87 YQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSS 151
            |:|.:.:.|:.|:.:||:|.:.||.|:|||.||.||.:.|.|..|||:|..|.|.|:|||||:|:
  Rat   136 YRLNFSKDDFAGVEILRVPSEHVWLPEIVLENNIDGQFGVAYDCNVLVYEGGSVSWLPPAIYRST 200

  Fly   152 CTIDVTYFPFDQQTCIMKFGSWTFNGDQVSL---------ALYNNKNFVDLSDYWKSGTWDIIEV 207
            |.::|||||||.|.|.:.|.|.|:|.::|..         |:  ||..:|.:.:.::|.|.|...
  Rat   201 CAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFIFAVDDDGNAI--NKIDIDTAAFTENGEWAIDYC 263

  Fly   208 PAYLNVYEGDSNH-PTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEA-GEKVTL 270
            |..:..|||.|.. |.|||:.:.:|||||.|||.:|:|:|.||||.|.:|.::|||:| |:|.|:
  Rat   264 PGMIRHYEGGSTEDPGETDVIYTLIIRRKPLFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTV 328

  Fly   271 GISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPM 335
            .|::||:..|||.|:::.:|.|||.:||:.:||:|..::.|:.::..||::|.:.|.|.||....
  Rat   329 SINVLLAQTVFLFLIAQKIPETSLSVPLLGRYLIFVMVVATLIVMNCVIVLNVSLRTPTTHATSP 393

  Fly   336 YIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGSPAELPKHISAIGGKQSKMEV 400
            .:|.|.|..||..|.:..|        .|.||.:.||....|.|......:.|.    |:.:.|:
  Rat   394 RLRQILLELLPRLLGLSPP--------PEDPGAASPARRASSVGILLRAEELIL----KKPRSEL 446

  Fly   401 MELSDLHHPNCKINRKVNSGGELGLGDGCRRESESSDSILLSPEASKATEAVEFIAEHLRNEDLY 465
            :.....|.           .|.......|:..|.:      :||.....:||.|:||..|:::..
  Rat   447 VFEGQRHR-----------HGTWTAAALCQNLSAA------APEVRCCVDAVNFVAESTRDQEAT 494

  Fly   466 IQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILM--------DAPH 504
            .:...||..:...:|.:..:...::.:.|:..|.:        |.|:
  Rat   495 GEELSDWVRMGKALDNVCFWAALVLFSVGSTLIFLGGYFNQVPDLPY 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 165/489 (34%)
Neur_chan_LBD 28..236 CDD:280998 87/219 (40%)
Neur_chan_memb 243..498 CDD:280999 72/256 (28%)
ChrneXP_017452660.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.803 Consistency score
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.