DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and acr-6

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_491354.2 Gene:acr-6 WormBaseID:WBGene00000045 Length:551 Species:Caenorhabditis elegans

Alignment Length:564 Identity:172/565 (30%)
Similarity:278/565 (49%) Gaps:104/565 (18%)


  Fly    14 LVLVAFSL-VSASEDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKSN 77
            |:|:.||: :.:....:.|...|...|||:..|.......:.:.|.|...|:::|:||:|::...
 Worm     5 LILLLFSIRLCSFTAYKSLFETLLARYNKIAFPSGEFNNTLTIEFKLRLDQIVDVHEKDQVITLK 69

  Fly    78 VWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLW 142
            ..|...|.||:|.|:..::|.|.::..|.:.:|.|||:|:|||.|:..|...:.|.:...|.|.|
 Worm    70 GTLIHHWLDYRLSWNPDEFGNITLMHFPGEMLWLPDIILYNNAHGSPWVSETTQVHVSFEGRVTW 134

  Fly   143 VPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLA-----------------LYNNKNF 190
            .||.:|.:.|.||:.::|:|.|.|.:||||||:.|.|::|.                 ::..:..
 Worm   135 QPPVVYDAFCNIDIEWYPYDLQICELKFGSWTYGGSQLNLIHLTTDQANESTDATGDNVWKVERG 199

  Fly   191 VDLSDYWKSGTWDIIEVPAYLNVYEG--------DSNHPTETDITFYIIIRRKTLFYTVNLILPT 247
            ||||:|.:|..||::.|       ||        ..::|: .|||:|:.||||.||||||:|:|.
 Worm   200 VDLSNYQESVEWDLLSV-------EGIRHKKWYPCCDYPS-IDITYYLHIRRKKLFYTVNMIIPC 256

  Fly   248 VLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTV 312
            |.::.:.:.|||||.|:.:|:.|.||:|::|.::.|::..|:||||:|.|||.|||.||.||..:
 Worm   257 VCLASMTLWVFYLPCESHQKIQLCISVLVALTLYFLMLIDIIPPTSIVTPLILKYLSFTMIMVAL 321

  Fly   313 SILVTVIIINWNFRG---PRTHRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHP 374
            |:..||.|.|.::|.   |    ||.:::..|:..|...|.:.  |||.                
 Worm   322 SVTCTVFIQNIHYRAYYQP----MPRFVKHWFIEKLGKKLLIS--RKTE---------------- 364

  Fly   375 HPSYGSPAELPKHISAIGG-----KQSKMEVMELS---------------------DLHHPNCKI 413
            ...|...|:..|.::|:..     ||.:..:.||.                     :|...|..:
 Worm   365 QAQYHRTAQHVKQVNALSAMNILEKQFQKTLFELEIATMAKKTVTAAPKTVNSIFLELPMMNRSV 429

  Fly   414 NRKVNSGGELGLGDGCRR--ESESSDSIL------LSPEASKATEA-----------VEFIAEHL 459
            :.|:.......:.:..||  ..:.:|.|.      :|||.:|.|:.           :.|||:.|
 Worm   430 SVKIRKPSVKAVKNRMRRLLSIDMTDDIRGKETEEISPETTKDTDPDREKLRKAEKNIHFIAKTL 494

  Fly   460 RNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILMDAP 503
            .:|....:...||::|::||||:.|.||....|.||:..:..||
 Worm   495 TDERRAQEAEADWQFVSLVIDRMLLIIFSFTITIGTILTIFSAP 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 170/560 (30%)
Neur_chan_LBD 28..236 CDD:280998 75/233 (32%)
Neur_chan_memb 243..498 CDD:280999 85/303 (28%)
acr-6NP_491354.2 Neur_chan_LBD 23..244 CDD:280998 74/229 (32%)
Neur_chan_memb 252..524 CDD:280999 82/294 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.