DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and lgc-17

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_510028.2 Gene:lgc-17 WormBaseID:WBGene00011359 Length:401 Species:Caenorhabditis elegans

Alignment Length:362 Identity:88/363 (24%)
Similarity:160/363 (44%) Gaps:45/363 (12%)


  Fly    10 LCSIL------VLVAFSLVSASEDEERLVRDLFRGYNKLI----------RPVQNMTQKVGVRFG 58
            :|.|.      ||.....:.....::.|.||||..|:..|          .|..|.|:.|. |:.
 Worm    12 ICEIATFYYNPVLYVPDWIDYLNHQDNLTRDLFANYDPTISSVYSSSFDYEPSHNHTRTVD-RWN 75

  Fly    59 ----LAFVQLINVNEKNQIMKSNVWLRLV--WYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLF 117
                |.:::|:.|.|..:  |.:|.|.||  |||.:|.|:.:.|..|..:.:..:|||.|.:..|
 Worm    76 YTILLYYLKLVEVQEPEE--KVSVVLELVEQWYDPRLSWNSSLYSNIPTVFVRQEKVWSPTLSAF 138

  Fly   118 ------NNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFN 176
                  :..|.::.:     |.|...|.:.........|:|.:||:.||||.|||.:.|....||
 Worm   139 GVNEIIDFRDQDFRI-----VSIDDIGYIQDYLSVRVSSNCPMDVSRFPFDSQTCQICFCLPIFN 198

  Fly   177 GDQVSL--ALYNNKNFVDLSDYWKSGTWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFY 239
            ..||.:  .:|.......:.....:..|.::.:...:...:.|.::.......|.|.|||..|:|
 Worm   199 IRQVKILNEIYEGILQEKIIKTMGNSEWKVVSLTNRVEQLKYDDDYGNMDLAVFEITIRRNPLYY 263

  Fly   240 TVNLILPTVLISFLCVL-VFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYL 303
            ...::.|:.:|:.:.:: :|...|:...|:.:|::.::::...|.:::..:|.|..: ||:..|:
 Worm   264 IYMIVFPSFVINGISIVGIFLKSADKMSKLNVGLTNIMTMTFILGVMADKIPRTGSI-PLLGIYI 327

  Fly   304 LFTFIMNTVSILVTVIII---NWNFRGPRTHRMPMYI 337
            :...::..::|.|.|:|.   .|..  ||......||
 Worm   328 IINLLIMIIAITVVVLITELRQWAV--PRLKLKKSYI 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 88/363 (24%)
Neur_chan_LBD 28..236 CDD:280998 61/232 (26%)
Neur_chan_memb 243..498 CDD:280999 21/100 (21%)
lgc-17NP_510028.2 Neur_chan_LBD 36..260 CDD:280998 61/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.