DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and lgc-16

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_510027.2 Gene:lgc-16 WormBaseID:WBGene00011358 Length:401 Species:Caenorhabditis elegans

Alignment Length:362 Identity:81/363 (22%)
Similarity:151/363 (42%) Gaps:77/363 (21%)


  Fly    13 ILVLVAFSLVSASED---------------EERLVRDLFRGYNKLIRPV-------------QNM 49
            |:.|.:||.:||...               :|.|..|||..|:..|..|             ...
 Worm     6 IVTLFSFSDISAFYHDPGLYAPGWIDYLNLQENLTNDLFANYDPTISTVYADIADWEPLGDNPRT 70

  Fly    50 TQKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLV--WYDYQLQWDEADYGGIGVLRLPPDKVWKP 112
            ..:......|.:::|:.|.|..:  |.:|.|.||  |||.:|.|:.:.|..:..:....:|||.|
 Worm    71 IDRWNYTILLYYLKLVEVQEPAE--KVSVVLELVERWYDPRLSWNISLYSNVSTIFARQEKVWSP 133

  Fly   113 --------DIVLFNNAD------------GNY-EVRYKSNVLIYPTGEVLWVPPAIYQSSCTIDV 156
                    :|:.|.:.|            .:| .||..:|                    |.:||
 Worm   134 TLSPFGVNEIIDFRDQDFRLISIDFTGYLNDYLSVRVSAN--------------------CPMDV 178

  Fly   157 TYFPFDQQTCIMKFGSWTFNGDQVSL--ALYNNKNFVDLSDYWKSGTWDIIEVPAYLNVYEGDSN 219
            :.||||.|||.::|....||..||.:  .:|.......:.....:..|.::.:...:...:.|.:
 Worm   179 SRFPFDSQTCQIRFCLPIFNIRQVKILNEIYEGILQEKIIKTMGNSEWKVVSLTNRVEQLKYDDD 243

  Fly   220 HPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVL-VFYLPAEAGEKVTLGISILLSLVVFLL 283
            :.......|.|.|||..|:|...::.|:.:|:.:.:: :|...|:...|:.:|::.::::...|.
 Worm   244 YGNMDLAVFEITIRRNPLYYIYMIVFPSFVINGISIVGIFLKSADKMSKLNVGLTNIMTMTFILG 308

  Fly   284 LVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVII 320
            :::..:|.|..: ||:..|::...::..::|.|.|:|
 Worm   309 VMADKIPRTGSI-PLLGIYIIINLLIMIIAITVVVLI 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 81/363 (22%)
Neur_chan_LBD 28..236 CDD:280998 57/246 (23%)
Neur_chan_memb 243..498 CDD:280999 16/80 (20%)
lgc-16NP_510027.2 Neur_chan_LBD 36..260 CDD:280998 57/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.