DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and acr-8

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_509745.2 Gene:acr-8 WormBaseID:WBGene00000047 Length:537 Species:Caenorhabditis elegans

Alignment Length:512 Identity:181/513 (35%)
Similarity:287/513 (56%) Gaps:68/513 (13%)


  Fly    19 FSLVSASEDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLV 83
            |..|:.:...:::..||...|||.:||::|.::.|.|:||.:.:::|:|:|.||::.:|:||.:.
 Worm    16 FFYVNPNRYADQMYEDLLYYYNKNVRPIKNASESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQ 80

  Fly    84 WYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIY 148
            |:||:|.||...:|.|..|.:|.|::|.|||:|:|||||...:...|:.::|..|.|:|.||:||
 Worm    81 WFDYRLMWDPGRWGKIRKLHVPVDQIWIPDILLYNNADGEPHITIMSDAIVYYNGLVVWKPPSIY 145

  Fly   149 QSSCTIDVTYFPFDQQTCIMKFGSWTFNG----------DQVSLALYNNKNFV-----DLSDYWK 198
            :|.|:||:.|||:|.|||.||||.||:||          ::.:|.:...|..|     .:|.:::
 Worm   146 KSFCSIDIEYFPYDTQTCWMKFGGWTYNGFLLDVRQLPVEEWTLVVTTRKLQVCAHASSISFFFR 210

  Fly   199 SGTWDIIEVPA--YLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLP 261
            |..||::|:.:  :..:|.|........||||.|.|||||||||:||::|..:.:.|..:|||:|
 Worm   211 SLEWDLMELNSARHEKIYAGCCGQDFYIDITFKIEIRRKTLFYTINLMIPCTMFAILTSIVFYVP 275

  Fly   262 AEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFR 326
             ....|:|..||||::|.||.|::..::||||||:|||.||||||..:.::||:::||.:|:..|
 Worm   276 -PIEHKMTFSISILVTLTVFYLILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRR 339

  Fly   327 GPRTHRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGSPAELPKHISAI 391
            ...:..||.:::.:|:|.||.::.:|...:                      ...::....||.|
 Worm   340 DGSSFPMPHWMKVVFIHTLPRYICIKTAEE----------------------DDGSDRGSSISDI 382

  Fly   392 GGKQSKMEVMELSDLHHPN---CKINRKVNSGGELGLGDGCRRESESSDSILLSPEASKATEAVE 453
            |         ...|...|:   ..:|.:..:|          |.||.....:.........:.||
 Worm   383 G---------PFMDSRRPSPFFITVNERQLNG----------RLSELKKKGMHPDLIRNMIQNVE 428

  Fly   454 FIAEH---LRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILMDAPHIFE 507
            ||||:   |:.||   :..|||.|||.||||:.|.||.|:...||..||:::|.:|:
 Worm   429 FIAEYFNSLKKED---KVSEDWSYVANVIDRIFLIIFSIMNVVGTWVILLNSPALFD 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 179/504 (36%)
Neur_chan_LBD 28..236 CDD:280998 88/225 (39%)
Neur_chan_memb 243..498 CDD:280999 81/261 (31%)
acr-8NP_509745.2 Neur_chan_LBD 25..250 CDD:280998 88/225 (39%)
LIC 26..475 CDD:273305 177/494 (36%)
Neur_chan_memb 257..473 CDD:280999 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.