DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and des-2

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001256321.1 Gene:des-2 WormBaseID:WBGene00000955 Length:559 Species:Caenorhabditis elegans

Alignment Length:490 Identity:137/491 (28%)
Similarity:219/491 (45%) Gaps:103/491 (21%)


  Fly     9 LLCSILVLVAFSLVSAS---EDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEK 70
            ::.|:|:....||..|.   ..:.|||.||...|:|..:|:.:.::.:.|.|.:...|::.:||.
 Worm     4 IIQSLLLATTASLCIADTPVPTQIRLVHDLLDNYDKKAKPMWDNSKPINVSFSMDLYQILELNEP 68

  Fly    71 NQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNN---ADGNYEVRYKSNV 132
            .|.:..|.|:...|:|..|.|:..||..|..||||.|.:|.||..|:|:   .|.:......|.:
 Worm    69 QQYILLNAWIIERWFDEFLYWNPDDYENITELRLPYDSIWLPDTTLYNSLVMKDDDTRRLLNSKL 133

  Fly   133 ------------LIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALY 185
                        |:|||         ||:.||.:|:.:||||.|.|.|.|.|||::...:....|
 Worm   134 TTDTHRRAALIELLYPT---------IYKFSCLLDLRFFPFDVQVCTMTFSSWTYDQKGIDYFPY 189

  Fly   186 NNKNFVDLSDYWKSGTWDIIE--VPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTV 248
            ::|  :..|:|.::..|.|::  :......|....|:.|...:|.|  :|||.|||.||||:||.
 Worm   190 SDK--IGTSNYLENEGWYILQTKIKRQEVKYACCPNNYTLLQLTLY--LRRKPLFYLVNLIIPTS 250

  Fly   249 LISFLCVLVFYLPAEAG----EKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIM 309
            :|:.:.::.|:..:.|.    |||:|||:.|||:.:.:|:||..:|.||..:|||..::|...|:
 Worm   251 IITLIAIVGFFTTSSASGMREEKVSLGITTLLSMSILMLMVSDQMPTTSTFIPLIGWFILAMIIV 315

  Fly   310 NTVSILVTVIIINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMKRPRKTR--LRWMMEMPGMSMPA 372
            .::..:|:.:||....||....||                 .||..|..  |.|.          
 Worm   316 ISLGTVVSSVIIAIQKRGSLGERM-----------------SKRALKFAKVLAWF---------- 353

  Fly   373 HPHPSYGSPAELPKHISAIGGKQSKMEVMELSDLHHPNCKIN-------------------RKVN 418
                   :...||.|:       .|..:||..|...|..::.                   |:..
 Worm   354 -------TCTSLPPHV-------EKEHMMEAFDAPTPLVEVRPLQLASVKESVRNKWVSGARRAT 404

  Fly   419 SGGELGLGDGCRRESESSDSIL-LSPEASKATEAV 452
            ..|..||   .....:|:|.:: |||.|.:..|::
 Worm   405 QRGNSGL---ALISDKSTDPLIHLSPTAHQPDESI 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 137/491 (28%)
Neur_chan_LBD 28..236 CDD:280998 69/225 (31%)
Neur_chan_memb 243..498 CDD:280999 58/237 (24%)
des-2NP_001256321.1 Neur_chan_LBD 28..222 CDD:280998 62/205 (30%)
Neur_chan_memb 245..>363 CDD:280999 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.