DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and lgc-20

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_496423.1 Gene:lgc-20 WormBaseID:WBGene00007191 Length:454 Species:Caenorhabditis elegans

Alignment Length:323 Identity:70/324 (22%)
Similarity:136/324 (42%) Gaps:61/324 (19%)


  Fly    46 VQNMTQKVGVRFGLAFVQLINVNEKNQIMKSNVW--LRLVWYDYQLQWDE----ADYGGIGVLRL 104
            ::|:..|        :|:|:    |....:.||:  :.|.|.|.:::||:    .:|..:.:.. 
 Worm    72 IENVLVK--------YVELV----KGSSYQFNVFGDIYLNWKDERMKWDKKGEFENYEHLYIFN- 123

  Fly   105 PPDKVWKPDIV---LFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTC 166
             ...:|.|.::   |.:....:|.|   .:|.||..|.:.......|.:|||:|...||.:..:|
 Worm   124 -SSAIWTPHVIDHTLCSEGGCSYSV---DDVDIYDDGTIYARIQFKYLASCTVDYRKFPEEDDSC 184

  Fly   167 IMKFGSWTFNGDQVSLAL------------YNNKNF---VDLSD-YWKSGTWDIIEVPAYLNVYE 215
            .:.|.::..|.:|.:|.|            |..|.:   ..||| ..:...|.::|.....:...
 Worm   185 CIFFTAFEPNVEQTTLVLEGKEKEKMNRPVYAQKIYEKEKQLSDIVQEHSPWVVVEKTMSTSNLG 249

  Fly   216 GDSNHPTETDITFYIIIRRKTLFYTVN--LILPTVLISFLCVLVFYLPAEAGEKVTLGI-SILLS 277
            |     .::.....:.:|.:....||.  |:.|..|.::: :|...|..:...::.:.: |:.:.
 Worm   250 G-----LKSLQVMQVCVRAEKQMSTVRVALLFPVTLATYV-MLASPLFGDLRTQIYVKLFSLHIQ 308

  Fly   278 LVVFLLLVSKILPPTSL--VLPLIAKYLLFTFIMNTVSILVTVII-----INWNFRGPRTHRM 333
            .:.||.|.: |.|....  |.|.|..:....|.::.:|||||:::     :..|.  |.:||:
 Worm   309 TLCFLYLCT-ITPLNGFLGVRPRIYIFYELIFTISFMSILVTLVVMALSRVKRNV--PPSHRL 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 70/324 (22%)
Neur_chan_LBD 28..236 CDD:280998 44/215 (20%)
Neur_chan_memb 243..498 CDD:280999 24/100 (24%)
lgc-20NP_496423.1 Neur_chan_LBD <88..>188 CDD:280998 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.