DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and unc-38

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_491472.1 Gene:unc-38 WormBaseID:WBGene00006774 Length:511 Species:Caenorhabditis elegans

Alignment Length:531 Identity:212/532 (40%)
Similarity:305/532 (57%) Gaps:76/532 (14%)


  Fly     8 WL-LCSILVLVAF-SLVSASEDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEK 70
            || |..:|..::| .|...:||.:||..||...||:..||..:..:.:.::..|...|:|:|:|.
 Worm     5 WLFLLLLLFCISFIKLTEGNEDAKRLYDDLMVNYNRHRRPSTSPNKPLTIKLKLRLSQIIDVHEI 69

  Fly    71 NQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIY 135
            :|||..:|||:..|.|.:|.||..:|||:.||.:|.:.:|.|||||:||||.||.:...:...::
 Worm    70 DQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNITISTKATLH 134

  Fly   136 PTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLAL------YNN------- 187
            .||||.|.||||::|.|.|||.:||||:|.|.:|||||||:.:.:|:.|      |..       
 Worm   135 YTGEVTWEPPAIFKSMCQIDVRWFPFDEQQCHLKFGSWTFSENLLSVELNEPSLRYEEEIDEKGI 199

  Fly   188 -------KNFVDLSDYWKSGTWDIIEVPAYLNVYEGDSNHPT------ETDITFYIIIRRKTLFY 239
                   ::.:|||||:.|..|||:...|....    .|:|:      ..|:|:|:.:|||.|||
 Worm   200 IDNVTVAEDGIDLSDYYPSVEWDIMSRVAKRRA----KNYPSCCPQSAYIDVTYYLQLRRKPLFY 260

  Fly   240 TVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLL 304
            ||||:.|.|.||||.:||||||:::||||||.||||::|.:|.||:::|:|.||:.||||.||||
 Worm   261 TVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLIGKYLL 325

  Fly   305 FTFIMNTVSILVTVIIINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMS 369
            ||.:|.|:|::||||.:|.:||.|.||.||.:::.:||.:||..|||:||               
 Worm   326 FTMVMVTLSVVVTVISLNLHFRTPTTHLMPNWVKKVFLKWLPKLLFMRRP--------------- 375

  Fly   370 MPAHPHPSYGSPAELPKHISAIGGKQSKMEVMELSDLHHP-NCKINRKVNSGGELGLGDGCRRES 433
                                 |...:.|.:     |...| :.||...|::.....:|:..|..:
 Worm   376 ---------------------IDDYEEKFD-----DKKKPKDGKIALSVHAHRVSNVGNNIRNAT 414

  Fly   434 --ESSDSILLSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTV 496
              ::...:..||...||.|.:.||||.|:.:|...:..|||||||||:|||.|.||.|....|||
 Worm   415 IDDTIQKMYYSPPVVKAFENICFIAELLKKKDRDDKIDEDWKYVAMVLDRLFLLIFSIACFVGTV 479

  Fly   497 GILMDAPHIFE 507
            .||:.||.:::
 Worm   480 IILLRAPTLYD 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 210/523 (40%)
Neur_chan_LBD 28..236 CDD:280998 90/234 (38%)
Neur_chan_memb 243..498 CDD:280999 104/258 (40%)
unc-38NP_491472.1 Neur_chan_LBD 27..257 CDD:280998 90/234 (38%)
LIC 29..483 CDD:273305 202/499 (40%)
Neur_chan_memb 264..481 CDD:280999 104/258 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.