DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and Chrna2

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_659052.1 Gene:Chrna2 MGIID:87886 Length:512 Species:Mus musculus

Alignment Length:506 Identity:233/507 (46%)
Similarity:322/507 (64%) Gaps:29/507 (6%)


  Fly     8 WLLCSILV-LVAFSLVSASEDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKN 71
            :|.|.:|: .|.....|.:..|:||.:.||.|||:..|||.|.:..|.|||||:..|||:|:|||
Mouse    15 YLWCLLLMPAVLAQQGSHTHAEDRLFKHLFGGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKN 79

  Fly    72 QIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYP 136
            |:|.:||||:..|.||:|:||.|::|.|..||:|.:.:|.|||||:|||||.:.|.:.:...::.
Mouse    80 QMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFF 144

  Fly   137 TGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSGT 201
            ||.|.|||||||:|||:||||:||||||.|.|||||||:  |:..:.|...:..|||.|||:||.
Mouse   145 TGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTY--DKAKIDLEQMERTVDLKDYWESGE 207

  Fly   202 WDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGE 266
            |.||......|..:.|.......|:|:|.:|||..||||:|||:|.:|||.|.|||||||:|.||
Mouse   208 WAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGE 272

  Fly   267 KVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTH 331
            |:||.||:||||.|||||:::|:|.||||:|||.:|||||.|..|:||::||.::|.:.|.|.||
Mouse   273 KITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH 337

  Fly   332 RMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHP----HPSYGSPAELPKHISAIG 392
            .||.::|...|..:|.:|.|.||          :|.|.:...|    .|:|   ..|..::.|..
Mouse   338 NMPNWVRVALLGRVPRWLMMNRP----------LPPMELHGSPGLKLSPTY---HWLETNMDAEE 389

  Fly   393 GKQSKMEVMELSDLHHPNCKINRKVNSG-----GEL---GLGDGCRRESESSDSILLSPEASKAT 449
            .::::.|..|..|.:...|......:.|     |.|   .:|...:..|::|: |||||:..||.
Mouse   390 REETEEEEEEEEDENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQASE-ILLSPQIQKAL 453

  Fly   450 EAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILM 500
            |.|.:||:|||:||.....:|||||||||:||:.|::|.||...||:|:.:
Mouse   454 EGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFL 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 233/505 (46%)
Neur_chan_LBD 28..236 CDD:280998 107/208 (51%)
Neur_chan_memb 243..498 CDD:280999 116/267 (43%)
Chrna2NP_659052.1 LIC 15..505 CDD:273305 233/507 (46%)
Neur_chan_LBD 36..242 CDD:280998 107/208 (51%)
Neur_chan_memb 249..503 CDD:280999 116/268 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.787 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.