DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and chrna2

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_004914998.1 Gene:chrna2 XenbaseID:XB-GENE-1013893 Length:510 Species:Xenopus tropicalis

Alignment Length:525 Identity:235/526 (45%)
Similarity:324/526 (62%) Gaps:53/526 (10%)


  Fly     4 SCKSWLLCSILVLVAFSLVSASE-----DEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQ 63
            :|....|..:..::.|:.||..|     .||||.:.||.|||:..|||.|.:..|.|:|||:..|
 Frog     3 NCMGRTLSILCWIITFTTVSCMERTRTHAEERLFKRLFTGYNRWSRPVPNTSDVVIVKFGLSIAQ 67

  Fly    64 LINVNEKNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRY 128
            ||:|:||||:|.:||||:..|.||:|:|:.|||..:..:|:|.:.:|.|||||:|||||.:.:.:
 Frog    68 LIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITH 132

  Fly   129 KSNVLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDL 193
            .:...::..|:|.|||||||:|||:||||:||||||:|.|||||||:  |:..|.|.:.:..|||
 Frog   133 MTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTY--DKAWLDLESMERNVDL 195

  Fly   194 SDYWKSGTWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVF 258
            .|||:||.|.|:......|..:.|.......|||:|.||||..||||:|||:|.:|||.|.||||
 Frog   196 KDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVF 260

  Fly   259 YLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINW 323
            |||::.|||:||.||:||||.|||||:::|:|.||||:|||.:|||||.|..|:||::||.::|.
 Frog   261 YLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNV 325

  Fly   324 NFRGPRTHRMPMYIRSIFLHYLPAFLFMKRP----------------RKTRLRWMMEMPGMSMPA 372
            :.|.|.||:||:::||:||.::|.:||||||                :.:..::.||.......|
 Frog   326 HHRSPSTHKMPLWVRSVFLDHIPRWLFMKRPPAPVEEVVSQYDAPELKLSTSKYWMETDVDDKWA 390

  Fly   373 HPHPSYGSPAELP----KHISAIGGKQSKMEVMELSDLHHPNCKINRKVN---SGGELGLGDGCR 430
            .|.      |||.    :|::.                |:.:.:.....|   |||:........
 Frog   391 EPE------AELQTCHVRHMTT----------------HNQSLQYRYDYNHHVSGGQSQTPRHSS 433

  Fly   431 RESESSDSILLSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGT 495
            .|:..| |.||||...||.|.|.:||.|||.||.....:||||||||||||:.|::|.||...||
 Frog   434 TETAES-SFLLSPSVLKALEGVHYIANHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGT 497

  Fly   496 VGILM 500
            ||:.:
 Frog   498 VGLFL 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 234/520 (45%)
Neur_chan_LBD 28..236 CDD:280998 105/208 (50%)
Neur_chan_memb 243..498 CDD:280999 119/278 (43%)
chrna2XP_004914998.1 LIC 11..503 CDD:273305 233/518 (45%)
Neur_chan_LBD 32..238 CDD:280998 105/208 (50%)
Neur_chan_memb 245..501 CDD:280999 119/279 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.