DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nAChRbeta1 and chrnb3

Sequence 1:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_002942943.1 Gene:chrnb3 XenbaseID:XB-GENE-5793509 Length:460 Species:Xenopus tropicalis

Alignment Length:482 Identity:188/483 (39%)
Similarity:276/483 (57%) Gaps:62/483 (13%)


  Fly    25 SEDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLVWYDYQL 89
            :|.|:.|:|.||.||.|.:|||.|....:.|.|||...||::|:||.|:|.:|||||..|.|.:|
 Frog    28 AEIEDALLRKLFAGYQKWVRPVLNPNSTIKVNFGLKISQLVDVDEKKQLMTTNVWLRQEWMDMKL 92

  Fly    90 QWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSCTI 154
            :|:..|||||..:|:|.:.:|.||||||.||||.:|....:..:|...|.|.|.|||.|:||||:
 Frog    93 RWNPKDYGGITYIRVPSESLWLPDIVLFENADGRFEGSLMTKAIIKYDGTVTWTPPASYKSSCTM 157

  Fly   155 DVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSGTWDIIEVPAYLNV-YEGDS 218
            |||:||||:|.|.|||||||::|:.|.|.|.:..  ||..|::.:|.|||:.......: .:|..
 Frog   158 DVTFFPFDRQNCSMKFGSWTYDGNMVDLILLDEN--VDRKDFFDNGEWDILNATGLKGMRKDGLY 220

  Fly   219 NHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLL 283
            ::|.   ||:..::||..||||:.||:|.:.:|||.|||||||::.|||::|..|:|:||.||||
 Frog   221 SYPF---ITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLL 282

  Fly   284 LVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRT-HRMPMYIRSIFLHYLPA 347
            ::.:|:|.:|.|:|||.:||||..|..|:||:|||.:||.:.|...| |.|..:::.:||..||.
 Frog   283 VIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMAPWVKRLFLEKLPK 347

  Fly   348 FLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGSPAELPKHISAIGGKQSKMEVMELSDLHHPNCK 412
            .|.||                     .|....|..:....:|:...|.|                
 Frog   348 LLCMK---------------------GHVDRFSFFDSESDVSSAKSKPS---------------- 375

  Fly   413 INRKVNSGGELGLGDGCRRESESSD--SILLSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYV 475
                           |.|:...:||  .:|:: ...||.:::::|:.|::.|....|..:|||:|
 Frog   376 ---------------GKRKNIHASDGEKVLIA-FLEKAADSIKYISTHVKKEHFIRQVVQDWKFV 424

  Fly   476 AMVIDRLQLYIFFIVTTAGTVGILMDA 502
            |.|:||:.|::|..|:..|:|.|...|
 Frog   425 AQVLDRIFLWLFLSVSITGSVLIFTPA 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 187/479 (39%)
Neur_chan_LBD 28..236 CDD:280998 96/209 (46%)
Neur_chan_memb 243..498 CDD:280999 85/258 (33%)
chrnb3XP_002942943.1 LIC 2..451 CDD:273305 187/481 (39%)
Neur_chan_LBD 31..235 CDD:280998 96/209 (46%)
Neur_chan_memb 242..448 CDD:280999 86/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.