DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and m

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_572747.1 Gene:m FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster

Alignment Length:391 Identity:105/392 (27%)
Similarity:173/392 (44%) Gaps:67/392 (17%)


  Fly   199 EYWDQEYAGHQHQHNG-TRVQHIEAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGS-G 261
            |.|..|      :.:| ..:..:|..|..|:|.:.:.|:..|.|::.|.|...||.|:|:..| |
  Fly    35 ELWPME------RPDGMPNIVSLEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTG 93

  Fly   262 RDYYEFYIQLNRCGTLGKNSLQEESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWK 326
            :.::.|.|..:||||  |..|..:       |..|||.|||:..:.|.:||..::.||:..|:.|
  Fly    94 KTFFSFRISYSRCGT--KPDLNGQ-------FYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEK 149

  Fly   327 TVTFP---FLDVEVA----TGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMR 384
            |.:.|   ..|::|.    .|:.|       :|:||||:|.|...|.|:|.|.:|..|||::.:.
  Fly   150 TASKPPMVIADLDVIQLDFRGDNV-------DCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAIN 207

  Fly   385 SKYDGFDIVVNDCYAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKTFRFT 449
            .....||:.|..|.|.:|:...|.|.|:.||.:..|:||||..:.:.........||:...|:|.
  Fly   208 DYRGEFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFP 272

  Fly   450 GSPALYIECDVRMCHGRCPSQPCHWRN----------------------LKAVTKRD-------- 484
            .:.:::|:|.|.:|...|..   |.:|                      ..|..::|        
  Fly   273 DALSVHIKCKVEICRHGCLD---HCQNTGVGGGGGGSGESLGLGLGLGLTNANERKDVHMSDALG 334

  Fly   485 -TSNMTATNISIPPLSADGEGLTTESPTANSLSENVNLFQSLRVLQEGETDGDDVYAHRQTKPLS 548
             :||....::::||....|.|:.. .|..:...|:: :....:.|..|.......|.|.::..|.
  Fly   335 SSSNDLLRDLALPPGGQHGMGMGM-GPDHDIFYEDI-IHDHKQTLGGGGMPAGGDYGHEKSVNLQ 397

  Fly   549 P 549
            |
  Fly   398 P 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 82/258 (32%)
Zona_pellucida <371..472 CDD:278526 30/101 (30%)
mNP_572747.1 ZP 55..286 CDD:214579 80/247 (32%)
Zona_pellucida <194..287 CDD:278526 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139553321
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3774
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008062
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46560
RoundUp 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.