DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and CG17111

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster

Alignment Length:448 Identity:84/449 (19%)
Similarity:153/449 (34%) Gaps:80/449 (18%)


  Fly   216 RVQHIEAE--CQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSGRDYYEFYIQL------N 272
            ||:.::..  |..|.|.|:......|.|.:|::  .:..||: ..|||.......:|:      |
  Fly   344 RVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYAS--MHSKDCL-ARGSGNGSVLLTLQIGSEVKEN 405

  Fly   273 RCGTLGKNSLQEESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWKTVTFPFLDVEV 337
            |||.|....:.:|.::   .|:...|.:|.||.::.:.|...||.|... :...::.....|..|
  Fly   406 RCGILRAYEMTQEYQR---TFISALVVIQNNPNVQTQGDRLIKVGCIQS-NATTSLGVSVRDSSV 466

  Fly   338 ATGNPVVFTLS------------PPECYMEIQNGYG-------------IGGPRVTGPVRVGDPL 377
            .:..||...::            |.|..:...:..|             :.....|..|::|..|
  Fly   467 DSSEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQILDLSHQHETNDVQIGQNL 531

  Fly   378 TLII-----------YMRSKYDGF-DIVVNDCYAHNGANKR-IQLIDQHGCPVDDKLISRFRGSW 429
            .|.|           :|..:.... |.......|....|:. :.|||:.|||.|..:........
  Fly   532 ELQIVAEYSPQQLAEHMELQLAPLPDFRATSLVAKTADNENFVLLIDERGCPTDASVFPALERVH 596

  Fly   430 SDSGVYETQVYAYMKTFRFTGSPALYIECDVRMCHGRCPSQPC---HWRNLKAVTKRDTSNMTAT 491
            :.|   .:.:.|....|:|:|:..:..:..:|.|..||....|   .|:..:....:........
  Fly   597 TAS---RSMLRARFHAFKFSGTANVSFDVKIRFCVERCSPSNCISSSWQRRRRQADQPDRRPEDL 658

  Fly   492 NISIPPLSADGEGLTTESPTANSLSENVNLFQSLRVLQEGETDGDD-VYAHRQT-------KPLS 548
            .:..|...:....:..:........|.:.|..::||....:::.:. :|..|..       .||.
  Fly   659 RVQNPVYISTVVDVAPQPDNFTRSQEELPLNYNIRVHGPDQSNTNSYLYGERGVLLIAGIDDPLH 723

  Fly   549 PHQTCLKTSTFSALTAGCSAVLCVLTVTLFIACSRLKRR---------KESSLYDSYI 597
            ....|:..|...||    .....:..|.|...|..:.:|         :...|::.|:
  Fly   724 LDNVCINQSLLIAL----FIFWLICQVALLFGCGMVLQRYRRLAKLEDERRRLHEEYL 777

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 62/299 (21%)
Zona_pellucida <371..472 CDD:278526 25/114 (22%)
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532 84/449 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139555338
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.