DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and CG10005

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_650137.3 Gene:CG10005 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster

Alignment Length:180 Identity:43/181 (24%)
Similarity:70/181 (39%) Gaps:35/181 (19%)


  Fly   188 AVPYENSKWQ----EEYWDQEYAG-HQHQHNGTRVQHIEAECQDDYMKIRIGFNGSFSGLLYSAG 247
            ||....:|.|    :|.|:|:.:. .:.:.:...:|.:..:|..|.|.:.:.....|.|::|:.|
  Fly    19 AVHVSANKQQKNQNQEIWEQDLSDTFKIEGSDQGIQKVNLKCGADSMNVVLETEKPFMGVMYTRG 83

  Fly   248 --YAYDPDCMY--INGSGRDYYEFYIQLNRCGTLGKNSLQEESRKNPTNFMWNTVTVQYNPLIEE 308
              |.....|..  .:..|....|...||::|.|:....|..           |.|.:|.:|.:..
  Fly    84 SFYKQSAPCFMKPSSSQGSRTMEMNFQLDQCQTIRDGDLYT-----------NIVVIQNDPELIT 137

  Fly   309 EYDEHFKVTCEYGYDFWKTVTFPFLDVE--------VATGNPVVFTLSPP 350
            ..|..|.:.|    ||.:...   ||||        ||||:.:..|...|
  Fly   138 PGDSAFSLEC----DFRQPRN---LDVEASMQARDRVATGSKITLTSPDP 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 35/141 (25%)
Zona_pellucida <371..472 CDD:278526
CG10005NP_650137.3 ZP 59..>162 CDD:214579 29/121 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139553915
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46560
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.