DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and zye

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_649220.1 Gene:zye FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster

Alignment Length:310 Identity:85/311 (27%)
Similarity:141/311 (45%) Gaps:57/311 (18%)


  Fly   217 VQHIEAEC-QDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYING--SGRDYYEFYIQLNRCGTLG 278
            ::.|:.:| |...|.:.:.|:..|.|::||.||..||.|.|:.|  |||. :.|.:..:.||:..
  Fly    55 IEKIDVKCDQGSGMMVEVEFSEDFEGVIYSQGYFSDPKCNYVKGDRSGRS-FTFTVPYDGCGSKP 118

  Fly   279 KNSLQEESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWKTVTF-PF-------LDV 335
            ..|:...        :.|.:.:|.:..|:..:|...|::|..|.:..|||.| ||       :.|
  Fly   119 SCSVCAS--------IENILIIQDDRDIQNSFDIARKISCSRGDEREKTVYFKPFVVDMLEVISV 175

  Fly   336 EVATGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVNDCYAH 400
            :..:|        |.||:|||..|.......:.|.:.:|..:|..|.::.....:||.:..|||.
  Fly   176 DTPSG--------PVECWMEIGTGTPPNVKPIQGTLTLGTDITFTINVKHSEQAWDINILQCYAS 232

  Fly   401 NG------ANKRIQLIDQHGCPVDDKLISRFR----GSWSDSGVYETQVYAYMKTFRFTGSPALY 455
            :.      ..||:||.|:.||.:.:|:...:|    ||...|..|.|     :|.|||.....:|
  Fly   233 DDMDFEARTTKRLQLSDKRGCSIKEKIFGEWRKFEAGSSLTSTYYNT-----LKAFRFPDRSQVY 292

  Fly   456 IECDVRMCHGRCPSQPCHWRNLKAVTKRDTSNMTATNISIPPLSADGEGL 505
            ::||:.:|:|.|              |||.:..:..:::.|..|.|.:.|
  Fly   293 LKCDIELCNGAC--------------KRDYTCGSLRSLTCPEGSTDPQCL 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 77/271 (28%)
Zona_pellucida <371..472 CDD:278526 32/111 (29%)
zyeNP_649220.1 ZP 61..313 CDD:214579 80/288 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139572693
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008062
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46560
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.