DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and dyl

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_647890.2 Gene:dyl FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster

Alignment Length:367 Identity:99/368 (27%)
Similarity:179/368 (49%) Gaps:40/368 (11%)


  Fly   144 HEVPDHVPDSSGYIPHRIGHPVHLDYGPTGVDSSGAPTG---SGGYHAVPYENSKWQEEYWDQEY 205
            |....|:..::..:.||.|      |||. ....|||.|   :|..:.|       .||.|..  
  Fly    27 HGDASHIESAALPLEHRAG------YGPP-APIYGAPQGPLSTGATNDV-------SEEAWPL-- 75

  Fly   206 AGHQHQHNGTRVQHIEAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYIN-GSGRDYYEFYI 269
               ...::..:::|::.:|:..:|::.|.|:..|.|:::|.|:..||.|:::. |:|.....|.|
  Fly    76 ---ASTNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEI 137

  Fly   270 QLNRCGTLGKNSLQEESRKNPT---NFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFW-KTVTF 330
            .||.||.....:........||   :::.||:.:||:|.::|.:|:..|:.|.: |||: |.|||
  Fly   138 FLNSCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTW-YDFYEKAVTF 201

  Fly   331 PFLDVEVATGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVN 395
            ....|::.......|.....:|:|:||.|.|.....|:|.|::|..:|:::.::...:.||::|.
  Fly   202 RPFQVDMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDENKFDMLVR 266

  Fly   396 DCYAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKTFRFTGSPALYIECDV 460
            :|.||:|....|||:||:||.|..|::|:|:...:.........:||.:.|:|..|..::.:|.:
  Fly   267 NCVAHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVI 331

  Fly   461 RMCHGRCPSQPCHWRNLKAVTKRDTSNMTATNISIPPLSADG 502
            ::|...||...|            ...:......:|.:.|:|
  Fly   332 QVCRYNCPEPKC------------GPGLPGGEYGLPQIGANG 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 78/255 (31%)
Zona_pellucida <371..472 CDD:278526 30/101 (30%)
dylNP_647890.2 ZP 90..345 CDD:214579 78/268 (29%)
Zona_pellucida <236..346 CDD:278526 33/122 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139553373
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3774
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008062
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46560
RoundUp 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.