DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and pio

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001163295.1 Gene:pio FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster

Alignment Length:421 Identity:92/422 (22%)
Similarity:157/422 (37%) Gaps:121/422 (29%)


  Fly   237 GSFSGLLYSAGYAYDPDCMYINGSGRDY---YEFYIQLNRCGTLGKNSLQEESRKNPTNFMWNTV 298
            |.|||::|..|.:.:..|:   ...||:   ..:.:.|..|.|:.|     |:......| :||:
  Fly    86 GLFSGMIYPKGLSKNSTCL---SEYRDHVGSLRYKLPLRSCNTMPK-----ETDDGGIEF-FNTI 141

  Fly   299 TVQYNPLIEEEYDEHFKVTC-------------------------------EYG----------- 321
            .:|.:..:..:....:.|.|                               |||           
  Fly   142 VLQPHLKLITDLGRGYHVRCAYKSRDAAMKPKKYLRKHAQKPQAFRSDDRREYGRSLDKQQDDDL 206

  Fly   322 -----YDFWKTVTFPFLDVEVATGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLII 381
                 ||    ...|..:.:| |.|.:..    |.|:|:|.|    ...::...|::|||||::|
  Fly   207 DEEDVYD----ANAPTQEEDV-TNNEIPM----PGCHMKIYN----DEHKIADDVKIGDPLTIVI 258

  Fly   382 YMRSKYDGFDIVVNDCYAHNGANKRIQ-LIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKT 445
            .: .|...:.:.|.||...:|.....| |:.:.|||:|::::.:|.        |.....|...|
  Fly   259 SI-DKQKVYGLHVTDCIVRDGLGWGEQRLVGEDGCPMDNEIMGQFN--------YTQDRLAANVT 314

  Fly   446 F---RFTGSPALYIECDVRMC---HGRCPSQP-CHWRNLKAVTKRDTSNMTATNISIPPLSADGE 503
            |   :|..:.::|.:|:||:|   ...|...| |..:..|.....|:.            ..||.
  Fly   315 FPAHKFPYTTSVYYQCNVRLCALEDPTCQEAPQCSGKRPKRQAAADSK------------EEDGL 367

  Fly   504 GLTTESPTANSLSENVNLFQSLRVLQEGETDGDDVYAHRQTKPLSPHQTCLKTSTFSALTAGCSA 568
            ..|.|..:...::||.|         ..::|.|.||   :.|.|. ...|:...|| |:....:.
  Fly   368 PATIEVFSGLYVNENEN---------ANDSDEDAVY---KEKTLD-DALCVSQRTF-AIAIAIAG 418

  Fly   569 VLCVLTVTLFIACSRLKRRKE------SSLY 593
            ::.:|.|...:.|...:|..:      ||:|
  Fly   419 LILMLAVVAAVLCIMARRSTKTVSNSGSSIY 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 66/294 (22%)
Zona_pellucida <371..472 CDD:278526 31/109 (28%)
pioNP_001163295.1 ZP 66..349 CDD:214579 66/294 (22%)
Zona_pellucida <248..349 CDD:278526 32/110 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139554108
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.