DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15020 and dy

DIOPT Version :9

Sequence 1:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_511130.2 Gene:dy / 32130 FlyBaseID:FBgn0004511 Length:699 Species:Drosophila melanogaster


Alignment Length:400 Identity:102/400 - (25%)
Similarity:177/400 - (44%) Gaps:81/400 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 QHEVPDHVP-------DSSGYIPHRIGHPVHLDYGPTGVDSSGAPTGSGGY-------------- 186
            ||.:|...|       ::...||...|.|    :||.      .|.|:..|              
  Fly   138 QHNMPQPPPNVALTMRNNHQNIPLSFGQP----FGPP------PPPGAQFYKGPPPPQLQQRPQP 192

  Fly   187 ------HAVPYENSKWQEEYWDQEYAGHQHQ---------------------HNGTRVQHIEAEC 224
                  ...|.:..:.|:::..|:  |.|.|                     .:..::..::.:|
  Fly   193 PPQLQLQVQPQQQQQQQQQHTQQQ--GQQQQVQVPDLSVGGSSNNEIWAAPVQDMPKIVSLDVKC 255

  Fly   225 QDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYI-NGSGRDYYEFYIQLNRCGTLGKNSL------ 282
            :.:.||:.:.|:..|:|:::|.|:..:.:|::: :|.||....|.|.|:.|||.|....      
  Fly   256 EKNGMKVFVQFDKPFNGIVFSKGHYSNMNCVHLPSGLGRSSASFDIGLHECGTAGNTDNYGQGYG 320

  Fly   283 QEESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWKTVTF-PF----LDVEVA--TG 340
            .|........:..|.:.:||:|.::|.:|:..|:.|.:...:.|:||| ||    |||..|  .|
  Fly   321 HEAGSTGAGTYFENIIVIQYDPQVQEVWDQARKLRCTWHDQYEKSVTFRPFPVDMLDVVRADFAG 385

  Fly   341 NPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVNDCYAHNGANK 405
            :.|       .|:|:||.|.|.....|:|.|::|..:|:::.::.....||::|.:|.||:|...
  Fly   386 DNV-------GCWMQIQVGKGPWASEVSGLVKIGQTMTMVLAIKDDDSKFDMLVRNCVAHDGKRA 443

  Fly   406 RIQLIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKTFRFTGSPALYIECDVRMCHGRCPSQ 470
            .|||:||.||....||:|||....:.........||:.:.|:|..|..::.:|.:::|...||.|
  Fly   444 PIQLVDQRGCVTRPKLMSRFTKIKNFGASASVLSYAHFQAFKFPDSMEVHFQCTIQICRYHCPEQ 508

  Fly   471 PCHWRNLKAV 480
            .....||:.|
  Fly   509 CSAETNLQDV 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 80/263 (30%)
Zona_pellucida <371..472 CDD:278526 32/100 (32%)
dyNP_511130.2 ZP 254..513 CDD:214579 80/265 (30%)
Zona_pellucida <403..510 CDD:278526 34/106 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473237
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14807
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.