DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and cutl-6

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_492000.2 Gene:cutl-6 WormBaseID:WBGene00012165 Length:374 Species:Caenorhabditis elegans

Alignment Length:394 Identity:84/395 (21%)
Similarity:145/395 (37%) Gaps:79/395 (20%)


  Fly   224 CQDDYMKIRIGFNGSFSGLLYSAGYAYDPDC--MYINGSGRDYYEFYIQLNRCGTLGKNSLQEES 286
            |.::.:.:.|..:..|.|.::..|.|.|..|  .|.|.....|   .:.|.:||      :|...
 Worm    39 CAENDLALDIVTSKPFRGNIFVKGRAKDKSCRQSYANNGTNSY---SLPLGKCG------MQRLR 94

  Fly   287 RKNP--TNFMWNTVTVQYNPL-IEEEYDEHFKVTCEYGYDFWKTVTFPFLDVEVATGNPVVFTLS 348
            ..||  .||| .||.|.::|. ...:.|..|.|.|.|...  ..:....:||.:.....:..::.
 Worm    95 SANPRGVNFM-VTVIVSFHPAGFITKNDRAFHVKCFYMEP--DEIVTQNIDVSMIPTTELSDSMV 156

  Fly   349 PPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVNDCYAHNGANKRIQLIDQH 413
            .|:|...::.. |..||.:| ...||| :...::..:..| ..::|..|:..:|..:...::|..
 Worm   157 MPKCEYSVRRD-GPNGPTLT-YANVGD-IVFHVWECTPAD-MGMLVKKCFVTDGDGEDHAVVDFD 217

  Fly   414 GCPVDDKLISRFRGSWSDSGVYET---QVYAYMKTFRFTGSPALYIECDVRMCH---GRCPSQPC 472
            ||..|..|:|...        |:.   :.:|..:.|::..|..||..|.:|:|.   |.|     
 Worm   218 GCATDPFLLSELS--------YDASLMRAHASSQVFKYADSNQLYFTCQIRLCQKQMGMC----- 269

  Fly   473 HWRNLKAVTKRDTSNMTATNISIPPL--SADGEGLTTESPTANSLSENVNLFQSLRVLQEGETDG 535
                         ..:|..|..:..|  .|.|:|..|:.....|..|.......|.||...:.. 
 Worm   270 -------------QEVTPPNCGVKKLLSEASGDGNRTKREADRSDYEIDVATSELLVLDPADRG- 320

  Fly   536 DDVYAHRQTKPLSPHQTCLKTSTFSALTAGCSAVLCVLTVTLFIACSRLKRRKESSLYDSYIAHK 600
                      .|:|...|:.......|     .::.:..|:|.:..:.|..|:::        ||
 Worm   321 ----------LLAPSPFCVPRLLLPVL-----PLILITIVSLTVVSTALVIRRQN--------HK 362

  Fly   601 GQID 604
            .::|
 Worm   363 KELD 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 61/260 (23%)
Zona_pellucida <371..472 CDD:278526 24/107 (22%)
cutl-6NP_492000.2 ZP 38..280 CDD:214579 63/283 (22%)
Zona_pellucida <169..277 CDD:278526 29/137 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97979
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.